![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf06551g00018.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 71aa MW: 8336.7 Da PI: 11.2903 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 82.2 | 3.4e-26 | 21 | 67 | 4 | 50 |
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
++ +nrqvtfskRrngilKK +ELSvLCd++va+i+fs++g+l ys
Niben101Scf06551g00018.1 21 NSLTNRQVTFSKRRNGILKKIYELSVLCDVDVAIIMFSPSGRLTHYS 67
6779****************************************998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PRINTS | PR00404 | 2.2E-18 | 12 | 32 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.2E-20 | 18 | 69 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 21.67 | 18 | 70 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 9.94E-22 | 21 | 68 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.0E-24 | 24 | 66 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-18 | 32 | 47 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-18 | 47 | 68 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MISFPPFVFG NQYFHNPKNT NSLTNRQVTF SKRRNGILKK IYELSVLCDV DVAIIMFSPS 60 GRLTHYSRKR R |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015160390.1 | 7e-28 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Refseq | XP_019254059.1 | 2e-26 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Swissprot | Q9LM46 | 7e-19 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
| TrEMBL | A0A0V0GZA3 | 3e-27 | A0A0V0GZA3_SOLCH; Putative MADS-box transcription factor 58-like (Fragment) | ||||
| STRING | Solyc05g051830.2.1 | 3e-25 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA13070 | 14 | 16 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G22130.1 | 3e-21 | AGAMOUS-like 104 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




