![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf06725g01001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 116aa MW: 13201.8 Da PI: 6.798 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 124.2 | 5.4e-39 | 21 | 114 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
reqd +lPia v+rim+ +lP++ak+s+dake++qe vse+i +t+ a+++c+re+r+t++++d++wa+ ++G+ +yv pl++y
Niben101Scf06725g01001.1 21 REQDLHLPIASVTRIMRLILPQHAKVSDDAKEVIQELVSEYINHITNLANERCHREQRRTVTAEDVIWAMNKIGLTNYVGPLTLY 105
89*********************************************************************************** PP
NF-YB 87 lkkyreleg 95
l+k+ e e+
Niben101Scf06725g01001.1 106 LQKHHEQEA 114
****99885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.7E-40 | 15 | 114 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.06E-32 | 23 | 114 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.5E-22 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.3E-8 | 54 | 72 | No hit | No description |
| PRINTS | PR00615 | 1.3E-8 | 73 | 91 | No hit | No description |
| PRINTS | PR00615 | 1.3E-8 | 92 | 110 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
MRGNSSTNNS NGTEAEQQAK REQDLHLPIA SVTRIMRLIL PQHAKVSDDA KEVIQELVSE 60 YINHITNLAN ERCHREQRRT VTAEDVIWAM NKIGLTNYVG PLTLYLQKHH EQEASG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 2e-42 | 21 | 111 | 7 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009784547.1 | 2e-65 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
| Swissprot | Q84W66 | 4e-43 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A1U7WXA5 | 4e-64 | A0A1U7WXA5_NICSY; nuclear transcription factor Y subunit B-6-like | ||||
| STRING | XP_009784547.1 | 7e-65 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA6044 | 4 | 36 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 1e-43 | nuclear factor Y, subunit B6 | ||||




