![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf07242g05005.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 80aa MW: 9128.61 Da PI: 10.7381 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 94.1 | 6.3e-30 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
k+ien++nrqvtfskRrng++KKA+ELSvLCd++va+i+fs++g++ ++s
Niben101Scf07242g05005.1 9 KKIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRVSTFS 58
78***********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.857 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.5E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.92E-37 | 2 | 75 | No hit | No description |
| SuperFamily | SSF55455 | 1.15E-31 | 2 | 78 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.0E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.9E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.0E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.0E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MGRVKLQIKK IENTTNRQVT FSKRRNGLIK KAYELSVLCD VDVALIMFSP SGRVSTFSGN 60 KSIEDIMARY VNLPEHDRGR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
| 6byy_B | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
| 6byy_C | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
| 6byy_D | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
| 6bz1_A | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
| 6bz1_B | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
| 6bz1_C | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
| 6bz1_D | 4e-19 | 1 | 80 | 1 | 79 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012851548.1 | 6e-50 | PREDICTED: MADS-box protein GGM13-like | ||||
| Refseq | XP_015158292.1 | 1e-49 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Refseq | XP_016568821.1 | 2e-49 | PREDICTED: agamous-like MADS-box protein AGL104 isoform X2 | ||||
| Swissprot | Q9LM46 | 8e-38 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
| TrEMBL | A0A022QCZ8 | 6e-49 | A0A022QCZ8_ERYGU; Uncharacterized protein | ||||
| TrEMBL | A0A1U8GBX3 | 4e-48 | A0A1U8GBX3_CAPAN; agamous-like MADS-box protein AGL104 isoform X2 | ||||
| TrEMBL | A0A2G2X1P3 | 3e-48 | A0A2G2X1P3_CAPBA; Uncharacterized protein | ||||
| STRING | Solyc04g078300.2.1 | 8e-49 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA6183 | 19 | 25 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G22130.1 | 3e-40 | AGAMOUS-like 104 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




