![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf07895g02005.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 115aa MW: 12897.8 Da PI: 7.772 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 144.3 | 3.7e-45 | 10 | 109 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85
+CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+++l+yeAear+rdPvyG+vg i+ lq+
Niben101Scf07895g02005.1 10 PCAACKFLRRKCLPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNTLAYEAEARVRDPVYGCVGAITFLQR 94
7************************************************************************************ PP
DUF260 86 qleqlkaelallkee 100
q+e+l++el+++++e
Niben101Scf07895g02005.1 95 QVERLEKELDAANAE 109
*********999876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 27.852 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.0E-43 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MSSSSCYNSP CAACKFLRRK CLPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP 60 HQREDAVNTL AYEAEARVRD PVYGCVGAIT FLQRQVERLE KELDAANAEL IRYAS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 7e-67 | 8 | 114 | 9 | 115 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 7e-67 | 8 | 114 | 9 | 115 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00581 | DAP | Transfer from AT5G63090 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009778337.1 | 2e-78 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_009778338.1 | 2e-78 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_016510977.1 | 2e-78 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_019248966.1 | 2e-78 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
| Swissprot | Q9FML4 | 2e-72 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A1J6IB20 | 4e-77 | A0A1J6IB20_NICAT; Protein lateral organ boundaries | ||||
| TrEMBL | A0A1S4DC18 | 4e-77 | A0A1S4DC18_TOBAC; protein LATERAL ORGAN BOUNDARIES-like | ||||
| TrEMBL | A0A1U7WEE4 | 4e-77 | A0A1U7WEE4_NICSY; protein LATERAL ORGAN BOUNDARIES-like | ||||
| STRING | XP_009778337.1 | 6e-78 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA43 | 24 | 669 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 8e-75 | LBD family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




