PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf10219g00008.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

Dof

Protein Properties

Length: 105aa MW: 11573.9 Da PI: 8.6146

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf10219g00008.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	102.8	2.1e-32	1	46	14	59
zf-Dof 14 tntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 ++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k Niben101Scf10219g00008.1 1 METKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAK 46 69******************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50884	24.027	1	47	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	3.1E-26	1	46	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	2.0E-21	1	46	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
METKFCYFNN YNVNQPRHFC KGCQRYWTAG GALRNVPVGA GRRKAKPPCG GSDGDMAAGL 60 SDGCFFDVTN HGNIHQLDFD GVVAEEWHLF PAAKRRRSTS GSQSC

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269\|PubMed:19619493}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009794806.1	1e-75	PREDICTED: dof zinc finger protein DOF1.5-like
Refseq	XP_016436859.1	7e-76	PREDICTED: dof zinc finger protein DOF1.5-like
Refseq	XP_016492835.1	1e-75	PREDICTED: dof zinc finger protein DOF1.5-like
Swissprot	P68350	4e-35	DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBL	A0A1S3XAL4	2e-74	A0A1S3XAL4_TOBAC; dof zinc finger protein DOF1.5-like
TrEMBL	A0A1S4BVE1	2e-74	A0A1S4BVE1_TOBAC; dof zinc finger protein DOF1.5-like
TrEMBL	A0A1U7XYV0	2e-74	A0A1U7XYV0_NICSY; dof zinc finger protein DOF1.5-like
STRING	XP_009794806.1	4e-75	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA7240	22	32

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29160.1	2e-37	Dof family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]