![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf11751g01010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 82aa MW: 9713.12 Da PI: 7.5148 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 54.7 | 2.3e-17 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg W +eEde+lv v+ lG +W+ Ia+ g+ R++k+c++rw++yl
Niben101Scf11751g01010.1 8 RGQWLEEEDERLVMIVAILGECRWDDIAKASGLQRSGKSCRLRWLNYL 55
899********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.977 | 1 | 59 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-20 | 2 | 58 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.2E-11 | 7 | 57 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.9E-15 | 8 | 55 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.06E-19 | 9 | 82 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.40E-9 | 11 | 55 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 9.8E-7 | 59 | 82 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MQQDELRRGQ WLEEEDERLV MIVAILGECR WDDIAKASGL QRSGKSCRLR WLNYLRPNLK 60 HGHITADEEH LIIQLQKQFG NK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 7e-14 | 5 | 82 | 24 | 100 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009804412.1 | 3e-50 | PREDICTED: transcription factor MYB48 | ||||
| Swissprot | Q9SCP1 | 7e-30 | MYB27_ARATH; Transcription factor MYB27 | ||||
| TrEMBL | A0A1U7YK03 | 7e-49 | A0A1U7YK03_NICSY; transcription factor MYB48 | ||||
| STRING | XP_009804412.1 | 1e-49 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA12 | 24 | 2154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53200.1 | 3e-32 | myb domain protein 27 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




