![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf13594g03006.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 80aa MW: 9531.98 Da PI: 8.4715 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 44.2 | 3.4e-14 | 4 | 76 | 18 | 90 |
--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
B3 18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90
+ kkf+ + + + + +l+ sg++W+v+++ r ++ yv+ +GW+ Fvk++ L+e D +vFk++++s+f
Niben101Scf13594g03006.1 4 IFKKFVLNLKDSYKLLGRKVLRGHSGNTWTVEVKRREDDDYYVFCNGWELFVKDHFLEEADLLVFKMKSSSSF 76
56666655533323333457899**********87777777*************************8877776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 12.774 | 1 | 80 | IPR003340 | B3 DNA binding domain |
| Pfam | PF02362 | 2.2E-11 | 2 | 76 | IPR003340 | B3 DNA binding domain |
| Gene3D | G3DSA:2.40.330.10 | 8.9E-14 | 4 | 79 | IPR015300 | DNA-binding pseudobarrel domain |
| SuperFamily | SSF101936 | 1.77E-14 | 5 | 78 | IPR015300 | DNA-binding pseudobarrel domain |
| CDD | cd10017 | 3.49E-12 | 23 | 79 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MLFIFKKFVL NLKDSYKLLG RKVLRGHSGN TWTVEVKRRE DDDYYVFCNG WELFVKDHFL 60 EEADLLVFKM KSSSSFDVSN |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009631052.1 | 1e-38 | PREDICTED: B3 domain-containing protein REM16-like | ||||
| Refseq | XP_016514932.1 | 9e-39 | PREDICTED: B3 domain-containing protein REM16-like | ||||
| TrEMBL | A0A1S4DND1 | 2e-37 | A0A1S4DND1_TOBAC; B3 domain-containing protein REM16-like | ||||
| STRING | XP_009631052.1 | 4e-38 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA13603 | 12 | 16 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G33280.1 | 1e-09 | B3 family protein | ||||




