PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf14708g00003.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

SBP

Protein Properties

Length: 95aa MW: 10837.3 Da PI: 8.7719

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf14708g00003.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	74.4	1.9e-23	26	74	1	49
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 +Cq+++C+adls+ak+yhrrhkvC+vhska+ +lv +++qrfCq Csr Niben101Scf14708g00003.1 26 ICQIDDCQADLSNAKDYHRRHKVCDVHSKAARALVGNVMQRFCQHCSRL 74 5***********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	1.9E-23	19	74	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	16.982	24	95	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.83E-22	25	76	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	6.4E-17	27	74	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
MEREEEEEKW QGKKTKVGGA SSKRAICQID DCQADLSNAK DYHRRHKVCD VHSKAARALV 60 GNVMQRFCQH CSRLGFNWTF FDYSLMRGSG VVLGV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj0_A	4e-21	27	74	6	53	squamosa promoter-binding protein-like 12
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269\|PubMed:16554053}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019253402.1	2e-35	PREDICTED: squamosa promoter-binding-like protein 1
Swissprot	Q9S7P5	1e-24	SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBL	A0A1J6IU13	4e-34	A0A1J6IU13_NICAT; Squamosa promoter-binding-like protein 1
STRING	Solyc05g053240.2.1	2e-32	(Solanum lycopersicum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G60030.1	1e-27	squamosa promoter-binding protein-like 12

Publications ? help Back to Top
Jung S, et al. Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes. BMC Genomics, 2006. 7: p. 81 [PMID:16615871] Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Chao LM, et al. Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage. Mol Plant, 2017. 10(5): p. 735-748 [PMID:28400323]