![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf15437g02005.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 107aa MW: 12599.5 Da PI: 8.4864 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 122.9 | 3.8e-38 | 1 | 106 | 267 | 373 |
GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
+f+s++++l r+ +eri+vE+++l+r+ivnv+aceg+er+erhe l+kW+ r+++aGF+++pls+++++ +k+llr ++ + y++
Niben101Scf15437g02005.1 1 MFESIDVTLERDRKERINVEQHCLARDIVNVIACEGKERVERHELLGKWKLRFTMAGFRQYPLSSYVNSVIKSLLRCYS-EHYTL 84
7**************************************************************************9999.66*** PP
GRAS 352 eeesgslvlgWkdrpLvsvSaW 373
e++g+++lgWkdr+L+s+SaW
Niben101Scf15437g02005.1 85 VEKDGAMLLGWKDRNLISASAW 106
********************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 18.666 | 1 | 88 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 1.3E-35 | 1 | 106 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 107 aa Download sequence Send to blast |
MFESIDVTLE RDRKERINVE QHCLARDIVN VIACEGKERV ERHELLGKWK LRFTMAGFRQ 60 YPLSSYVNSV IKSLLRCYSE HYTLVEKDGA MLLGWKDRNL ISASAWH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009788119.1 | 3e-72 | PREDICTED: scarecrow-like protein 21 | ||||
| Refseq | XP_009788120.1 | 3e-72 | PREDICTED: scarecrow-like protein 21 | ||||
| Refseq | XP_016463344.1 | 2e-72 | PREDICTED: scarecrow-like protein 21 | ||||
| Refseq | XP_016475625.1 | 3e-72 | PREDICTED: scarecrow-like protein 21 | ||||
| Swissprot | Q69VG1 | 2e-58 | CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1 | ||||
| TrEMBL | A0A1S3ZG68 | 6e-71 | A0A1S3ZG68_TOBAC; scarecrow-like protein 21 | ||||
| TrEMBL | A0A1S4AG00 | 7e-71 | A0A1S4AG00_TOBAC; scarecrow-like protein 21 | ||||
| TrEMBL | A0A1U7XNQ0 | 7e-71 | A0A1U7XNQ0_NICSY; scarecrow-like protein 21 | ||||
| STRING | XP_009788119.1 | 1e-71 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA21347 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G48150.2 | 2e-52 | GRAS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




