![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf39382g00003.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 93aa MW: 11218 Da PI: 10.5322 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 52.5 | 1.1e-16 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+WT++Ed++lv +vk++G ++W+ a+ g++Rt+k+c++rw +yl
Niben101Scf39382g00003.1 8 RGPWTEQEDLQLVFYVKLFGDRRWDFLAKVSGLKRTGKSCRLRWVNYL 55
89********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.496 | 3 | 59 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.0E-20 | 3 | 58 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 7.3E-13 | 7 | 57 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.0E-15 | 8 | 55 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.75E-21 | 9 | 82 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.30E-9 | 10 | 55 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.1E-7 | 59 | 82 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
MVQEEIRRGP WTEQEDLQLV FYVKLFGDRR WDFLAKVSGL KRTGKSCRLR WVNYLNPHLK 60 RGKMTPQEER LVLELHSKWG NRSAISLDSF FFF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 1e-17 | 1 | 84 | 20 | 102 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019263011.1 | 2e-53 | PREDICTED: transcription factor MYB48-like | ||||
| Swissprot | Q4JL84 | 2e-45 | MYB59_ARATH; Transcription factor MYB59 | ||||
| TrEMBL | A0A314L773 | 4e-52 | A0A314L773_NICAT; Transcription factor myb48 | ||||
| STRING | XP_009590049.1 | 8e-53 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA12 | 24 | 2154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G59780.3 | 8e-48 | myb domain protein 59 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




