![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OB01G30460.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 93aa MW: 10134.5 Da PI: 10.1956 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 65.9 | 6.6e-21 | 1 | 46 | 14 | 59 |
--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 14 evkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+vk+s++pr+YYrC+ gC+vkk+ver+++d ++v++tY g Hnh+
OB01G30460.1 1 MVKNSPNPRNYYRCSADGCRVKKRVERARDDARFVVTTYDGVHNHP 46
59*******************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF118290 | 3.01E-17 | 1 | 48 | IPR003657 | WRKY domain |
| SMART | SM00774 | 8.0E-17 | 1 | 47 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 2.9E-19 | 1 | 48 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 23.181 | 1 | 48 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.0E-15 | 2 | 46 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
| GO:0050832 | Biological Process | defense response to fungus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
MVKNSPNPRN YYRCSADGCR VKKRVERARD DARFVVTTYD GVHNHPAPPH PRPAAGYSIA 60 GPAAGHRLLG LKEEEAAAIA LFRSTSATSL HLP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ayd_A | 1e-14 | 2 | 49 | 28 | 75 | WRKY transcription factor 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | OB01G30460.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK108522 | 1e-61 | AK108522.1 Oryza sativa Japonica Group cDNA clone:002-144-B05, full insert sequence. | |||
| GenBank | AY341846 | 1e-61 | AY341846.1 Oryza sativa (japonica cultivar-group) WRKY5 mRNA, complete cds. | |||
| GenBank | CT831367 | 1e-61 | CT831367.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI006O16, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006646041.1 | 3e-62 | PREDICTED: probable WRKY transcription factor 45 | ||||
| Swissprot | Q8VWQ5 | 4e-20 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
| TrEMBL | J3L1E0 | 1e-61 | J3L1E0_ORYBR; Uncharacterized protein | ||||
| STRING | OB01G30460.1 | 2e-62 | (Oryza brachyantha) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP441 | 37 | 206 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26170.1 | 5e-20 | WRKY DNA-binding protein 50 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




