![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OB01G32460.1 | ||||||||
| Common Name | LOC102712670 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 78aa MW: 8965.86 Da PI: 5.1342 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 33.9 | 7.1e-11 | 33 | 71 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
+T+eE++l + +++ G++ W++Ia +++ gRt +++ +w
OB01G32460.1 33 FTEEEEDLVFRMHRLVGNR-WELIAGRIP-GRTTEEIEKFW 71
9******************.*********.*******9999 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 9.832 | 25 | 78 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.7E-7 | 29 | 77 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 4.21E-9 | 32 | 72 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.4E-13 | 32 | 71 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.57E-8 | 33 | 71 | No hit | No description |
| Pfam | PF00249 | 5.6E-10 | 33 | 71 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MESSSGSQEG KNSKTSDGSI QEVNSTAQNF VHFTEEEEDL VFRMHRLVGN RWELIAGRIP 60 GRTTEEIEKF WAIKHQDK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | OB01G32460.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT833447 | 3e-61 | CT833447.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA029N02, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006644376.1 | 1e-51 | PREDICTED: MYB-like transcription factor ETC3 isoform X1 | ||||
| Refseq | XP_006644377.1 | 1e-51 | PREDICTED: MYB-like transcription factor ETC3 isoform X1 | ||||
| Refseq | XP_015697875.1 | 1e-51 | PREDICTED: MYB-like transcription factor ETC3 isoform X1 | ||||
| Swissprot | B3H4X8 | 1e-21 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
| TrEMBL | J3L1Z0 | 3e-50 | J3L1Z0_ORYBR; Uncharacterized protein | ||||
| STRING | OB01G32460.1 | 5e-51 | (Oryza brachyantha) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5275 | 31 | 57 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G30424.1 | 6e-24 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 102712670 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




