PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OB02G15980.1

Organism

Oryza brachyantha

Taxonomic ID

4533

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MYB_related

Protein Properties

Length: 84aa MW: 9535.81 Da PI: 8.9872

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OB02G15980.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	63.2	5e-20	12	57	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + OB02G15980.1 12 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 57 79****************************.*********985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.481	7	62	IPR017930	Myb domain
SMART	SM00717	9.6E-17	11	60	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.5E-22	12	57	IPR009057	Homeodomain-like
Pfam	PF00249	3.1E-19	12	57	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.84E-22	13	84	IPR009057	Homeodomain-like
CDD	cd00167	8.69E-16	14	56	No hit	No description
Gene3D	G3DSA:1.10.10.60	6.4E-7	58	84	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 84 aa Download sequence Send to blast
MMGVEAECDR IKGPWSPEED EALRRLVERH GARNWTAIGR GIPGRSGKSC RLRWCNQLSP 60 QVERRPFTPD EDAAILRAHA RLGN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1mse_C	1e-21	11	84	3	76	C-Myb DNA-Binding Domain
1msf_C	1e-21	11	84	3	76	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	OB02G15980.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP003990	1e-106	AP003990.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1073_F05.
GenBank	AP004046	1e-106	AP004046.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1145_F01.
GenBank	AP014958	1e-106	AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001147631.1	6e-52	uncharacterized protein LOC100281240
Refseq	XP_025817137.1	6e-52	transcription factor MYB44-like
Swissprot	Q9FDW1	2e-37	MYB44_ARATH; Transcription factor MYB44
TrEMBL	J3LAD1	2e-54	J3LAD1_ORYBR; Uncharacterized protein
STRING	OB02G15980.1	3e-55	(Oryza brachyantha)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP789	38	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G67300.1	8e-40	myb domain protein r1

Publications ? help Back to Top
Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]