PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OB02G40680.1

Organism

Oryza brachyantha

Taxonomic ID

4533

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

bZIP

Protein Properties

Length: 186aa MW: 20410.2 Da PI: 9.073

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OB02G40680.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	48.7	1.6e-15	126	175	5	54
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 +r+rr++kNRe+A rsRqRK+a++ eLe +v++L++ N++L+k+ +e+ + OB02G40680.1 126 RRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNEELQKKQDEILE 175 79****************************************99888655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	4.0E-11	122	180	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.3	124	176	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	7.4E-14	126	176	IPR004827	Basic-leucine zipper domain
CDD	cd14707	3.32E-25	126	178	No hit	No description
Gene3D	G3DSA:1.20.5.170	4.4E-15	126	176	No hit	No description
SuperFamily	SSF57959	3.94E-11	126	175	No hit	No description
PROSITE pattern	PS00036	0	129	144	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 186 aa Download sequence Send to blast
MDFPGGSGRP QQQQLPPMTP LPLARQGSVY SLTFDEFQST LGGVGKDFGS MNMDELLRSI 60 WTAEESHAGG GGVAPLVSPV RPVSSNGFGK MEGGDLSSLS PSPVPYIFNG GLRGRKAPGI 120 EKVVERRQRR MIKNRESAAR SRQRKQAYMM ELEAEVAKLK ELNEELQKKQ DEILEQQKNE 180 GFGGCI

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that mediates abscisic acid (ABA) signaling (PubMed:18931143, PubMed:19947981, PubMed:27424498, PubMed:27325665). Can regulate the expression of a wide spectrum of stress-related genes in response to abiotic stresses through an ABA-dependent regulation pathway. Confers ABA-dependent drought and salinity tolerance (PubMed:18931143, PubMed:27325665). Binds specifically to the ABA-responsive elements (ABRE) in the promoter of target genes to mediate stress-responsive ABA signaling (PubMed:27325665, PubMed:27424498). {ECO:0000269\|PubMed:18931143, ECO:0000269\|PubMed:19947981, ECO:0000269\|PubMed:27325665, ECO:0000269\|PubMed:27424498}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	OB02G40680.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) (PubMed:18315698, PubMed:18931143). Induced by drought, salt and osmotic stresses (PubMed:18931143). {ECO:0000269\|PubMed:18315698, ECO:0000269\|PubMed:18931143}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KP779638	1e-123	KP779638.1 Oryza nivara OsbZIP23 (bZIP23) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015688745.1	1e-112	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
Swissprot	Q6Z312	2e-63	BZP23_ORYSJ; bZIP transcription factor 23
TrEMBL	J3LHF1	1e-132	J3LHF1_ORYBR; Uncharacterized protein
STRING	OB02G40680.1	1e-133	(Oryza brachyantha)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP706	38	147

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G45249.1	2e-28	abscisic acid responsive elements-binding factor 2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Xiang Y,Tang N,Du H,Ye H,Xiong L Characterization of OsbZIP23 as a key player of the basic leucine zipper transcription factor family for conferring abscisic acid sensitivity and salinity and drought tolerance in rice. Plant Physiol., 2008. 148(4): p. 1938-52 [PMID:18931143] Shen J,Xie K,Xiong L Global expression profiling of rice microRNAs by one-tube stem-loop reverse transcription quantitative PCR revealed important roles of microRNAs in abiotic stress responses. Mol. Genet. Genomics, 2010. 284(6): p. 477-88 [PMID:20941508] Luo C,Guo C,Wang W,Wang L,Chen L Overexpression of a new stress-repressive gene OsDSR2 encoding a protein with a DUF966 domain increases salt and simulated drought stress sensitivities and reduces ABA sensitivity in rice. Plant Cell Rep., 2014. 33(2): p. 323-36 [PMID:24247850] Sakuraba Y, et al. Rice ONAC106 Inhibits Leaf Senescence and Increases Salt Tolerance and Tiller Angle. Plant Cell Physiol., 2015. 56(12): p. 2325-39 [PMID:26443376] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774] Dey A,Samanta MK,Gayen S,Sen SK,Maiti MK Enhanced Gene Expression Rather than Natural Polymorphism in Coding Sequence of the OsbZIP23 Determines Drought Tolerance and Yield Improvement in Rice Genotypes. PLoS ONE, 2016. 11(3): p. e0150763 [PMID:26959651] Zong W, et al. Feedback Regulation of ABA Signaling and Biosynthesis by a bZIP Transcription Factor Targets Drought-Resistance-Related Genes. Plant Physiol., 2016. 171(4): p. 2810-25 [PMID:27325665] Dey A,Samanta MK,Gayen S,Maiti MK The sucrose non-fermenting 1-related kinase 2 gene SAPK9 improves drought tolerance and grain yield in rice by modulating cellular osmotic potential, stomatal closure and stress-responsive gene expression. BMC Plant Biol., 2016. 16(1): p. 158 [PMID:27411911] Gui J, et al. OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice. Dev. Cell, 2016. 38(2): p. 201-13 [PMID:27424498]