![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OB05G31090.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 139aa MW: 15443.8 Da PI: 10.8815 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 103.6 | 1.1e-32 | 60 | 118 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+s+fprsYYrCt+++C+vkk+v+r a+d +v++tYeg Hnh+
OB05G31090.1 60 LDDGYRWRKYGQKAVKNSDFPRSYYRCTHHTCSVKKQVQRLAKDRGIVVTTYEGVHNHP 118
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 4.0E-33 | 45 | 118 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.06E-28 | 52 | 119 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.105 | 55 | 120 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.2E-36 | 60 | 119 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.3E-26 | 61 | 118 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
XXSSTVTTAG GSSGVTEATA TTNRQLQGSA RRGRGNGRKA GGGGRTPRFA FHTRSENDVL 60 DDGYRWRKYG QKAVKNSDFP RSYYRCTHHT CSVKKQVQRL AKDRGIVVTT YEGVHNHPCE 120 KLMEALNPIL RQLQLLSQL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 4e-25 | 53 | 117 | 10 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 4e-25 | 53 | 117 | 10 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | OB05G31090.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | DQ840412 | 1e-102 | DQ840412.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 13 (WRKY13) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006655508.1 | 9e-98 | PREDICTED: probable WRKY transcription factor 43 | ||||
| Swissprot | Q9FFS3 | 3e-55 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
| TrEMBL | J3M935 | 1e-97 | J3M935_ORYBR; Uncharacterized protein | ||||
| STRING | OB05G31090.1 | 2e-98 | (Oryza brachyantha) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1100 | 38 | 133 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G41570.1 | 4e-55 | WRKY DNA-binding protein 24 | ||||




