![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OB08G15650.1 | ||||||||
| Common Name | LOC102715224 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 176aa MW: 19135.4 Da PI: 9.9926 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 100.3 | 1.9e-31 | 82 | 137 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
ep+YVNa+Qy++Il+RRq+Rak+e+e+k +ksrkpylheSRh hAl+R+Rgs+GrF
OB08G15650.1 82 EPIYVNARQYHGILRRRQSRAKAESENKA-NKSRKPYLHESRHLHALKRARGSSGRF 137
8****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 3.7E-32 | 79 | 140 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.553 | 80 | 140 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 4.5E-27 | 82 | 137 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 7.0E-23 | 83 | 105 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 7.0E-23 | 114 | 137 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 176 aa Download sequence Send to blast |
MKPDGETQLR PTAAGHPDPG LSTSSAEYVA PVGPATTQVA YPYIGTYYGG IYGAYSGQPL 60 VNAALMAMPP HSVPLATDVV LEPIYVNARQ YHGILRRRQS RAKAESENKA NKSRKPYLHE 120 SRHLHALKRA RGSSGRFLNS KAMEGKQDSK SVDKNDGALP AEENRDNKDT NSNTKS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 8e-20 | 82 | 141 | 3 | 62 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | OB08G15650.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB288027 | 0.0 | AB288027.1 Oryza sativa Japonica Group OsHAP2A mRNA for HAP2 subunit of HAP complex, complete cds. | |||
| GenBank | AK059903 | 0.0 | AK059903.1 Oryza sativa Japonica Group cDNA clone:006-208-G09, full insert sequence. | |||
| GenBank | HQ731479 | 0.0 | HQ731479.1 Oryza sativa Japonica Group NF-Y transcription factor 21 (NF-Y18) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015695809.1 | 1e-127 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
| Swissprot | Q84JP1 | 1e-35 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | J3MR36 | 1e-126 | J3MR36_ORYBR; Uncharacterized protein | ||||
| STRING | OB08G15650.1 | 1e-127 | (Oryza brachyantha) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP16558 | 13 | 13 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 3e-35 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 102715224 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




