![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OB12G11340.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 139aa MW: 15145 Da PI: 5.5856 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 136.4 | 3.1e-42 | 1 | 132 | 241 | 374 |
GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
+veq+++h s+sFl+rf+ea++yysalfdsl+a+++++s er++vE++ll+rei+nv+a g +r+ + + +++Wre+l ++GF+ +l +aa+qa
OB12G11340.1 1 MVEQDLSH-SGSFLARFVEAIHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFHVSSLAGSAAAQA 95
699****9.899****************************************************999987.************************** PP
GRAS 338 klllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
lll +++sdgy++ ee+g+l lgWkd L+++SaWr
OB12G11340.1 96 ALLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAWR 132
************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 19.612 | 1 | 112 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 1.1E-39 | 1 | 132 | IPR005202 | Transcription factor GRAS |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MVEQDLSHSG SFLARFVEAI HYYSALFDSL DASYSEDSPE RHVVEQQLLS REIRNVLAVG 60 GPARTGDVKF GSWREKLAQS GFHVSSLAGS AAAQAALLLG MFPSDGYTLI EENGALKLGW 120 KDLCLLTASA WRPIQTTGR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5b3g_A | 2e-71 | 1 | 133 | 248 | 380 | Protein SCARECROW |
| 5b3h_A | 2e-71 | 1 | 133 | 247 | 379 | Protein SCARECROW |
| 5b3h_D | 2e-71 | 1 | 133 | 247 | 379 | Protein SCARECROW |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor required for quiescent center cells specification and maintenance of surrounding stem cells, and for the asymmetric cell division involved in radial pattern formation in roots. Essential for cell division but not differentiation of the ground tissue. Regulates the radial organization of the shoot axial organs. Restricts SHR movment and sequesters it into the nucleus of the endodermis (By similarity). {ECO:0000250, ECO:0000269|PubMed:17446396}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | OB12G11340.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK243131 | 1e-168 | AK243131.1 Oryza sativa Japonica Group cDNA, clone: J100030A12, full insert sequence. | |||
| GenBank | AP014968 | 1e-168 | AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence. | |||
| GenBank | BX000506 | 1e-168 | BX000506.4 Oryza sativa chromosome 12, . BAC OJ1311_G04 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015698192.1 | 3e-97 | PREDICTED: protein SCARECROW 2-like | ||||
| Swissprot | Q2RB59 | 2e-90 | SCR1_ORYSJ; Protein SCARECROW 1 | ||||
| TrEMBL | J3NAX6 | 3e-97 | J3NAX6_ORYBR; Uncharacterized protein | ||||
| STRING | OB11G11140.1 | 5e-98 | (Oryza brachyantha) | ||||
| STRING | OB12G11340.1 | 5e-98 | (Oryza brachyantha) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1371 | 38 | 122 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54220.1 | 2e-61 | GRAS family protein | ||||




