![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OBART01G11000.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 127aa MW: 14276.8 Da PI: 5.0448 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 56.6 | 6.1e-18 | 49 | 94 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
rg W + Ed +l+d+v+q+G+ +W++Ia+++ gR++k+c++rw++
OBART01G11000.1 49 RGHWRPAEDAKLKDLVAQYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 94
899*****************************.***********996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 23.191 | 44 | 99 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.6E-21 | 47 | 98 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 4.7E-14 | 48 | 97 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.3E-16 | 49 | 94 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 6.36E-20 | 50 | 122 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 9.51E-13 | 52 | 93 | No hit | No description |
| PROSITE profile | PS50090 | 4.019 | 96 | 127 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 2.7E-7 | 99 | 122 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0051782 | Biological Process | negative regulation of cell division | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
MAHEMMGGFF GHPPPPPATA ALGEEEEEVV EETEEGGHGG GVQGKLCARG HWRPAEDAKL 60 KDLVAQYGPQ NWNLIAEKLD GRSGKSCRLR WFNQLDPRIN RRAFTEEEEE RLMAAHRAYG 120 NNDHQQE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 6e-18 | 47 | 121 | 5 | 79 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK107461 | 0.0 | AK107461.1 Oryza sativa Japonica Group cDNA clone:002-129-A05, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015631112.1 | 2e-84 | transcription factor CSA-like | ||||
| Swissprot | Q5NBM8 | 2e-85 | CSA_ORYSJ; Transcription factor CSA | ||||
| TrEMBL | A0A0D3EMA6 | 7e-89 | A0A0D3EMA6_9ORYZ; Uncharacterized protein | ||||
| STRING | OBART01G11000.1 | 1e-89 | (Oryza barthii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP294 | 38 | 260 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G17800.1 | 6e-46 | myb domain protein 56 | ||||




