![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OBART01G37040.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 142aa MW: 14941.1 Da PI: 10.3414 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 94.1 | 1.1e-29 | 29 | 82 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
k+r++WtpeLH+rFveav++L G++ A+Pk+i++lm+v+gLt+e+v+SHLQkYRl
OBART01G37040.1 29 KARMVWTPELHHRFVEAVAHL-GEKGAVPKAIVRLMNVDGLTRENVASHLQKYRL 82
68*******************.9*******************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.79E-20 | 26 | 86 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 11.768 | 28 | 85 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.8E-30 | 28 | 86 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 3.4E-25 | 29 | 82 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 2.4E-10 | 31 | 81 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 142 aa Download sequence Send to blast |
MRTGEGEGGN DDAPAAAAAG GGGGRCGKKA RMVWTPELHH RFVEAVAHLG EKGAVPKAIV 60 RLMNVDGLTR ENVASHLQKY RLYLKRTRVA ATPPPSPPPP PPPPPPLPPA MYVPCFAAKP 120 PLDAANRSDS PPSRTSDATT KQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5lxu_A | 2e-27 | 31 | 85 | 3 | 57 | Transcription factor LUX |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that is essential for the generation of the circadian clock oscillation. Is necessary for activation of CCA1 and LHY expression. Is coregulated with TOC1 and seems to be repressed by CCA1 and LHY by direct binding of these proteins to the evening element in the LUX promoter. Directly regulates the expression of PRR9, a major component of the morning transcriptional feedback circuit, by binding specific sites on PRR9 promoter. Binds to its own promoter, inducing a negative auto-regulatory feedback loop within the core clock. Binds to ELF3 and associates with ELF4 in a diurnal complex which is required for the expression of the growth-promoting transcription factors PIF4 and PIF5 and subsequent hypocotyl growth in the early evening. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:21236673, ECO:0000269|PubMed:21753751, ECO:0000269|PubMed:22311777}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:17132630, ECO:0000269|PubMed:21753751}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK066659 | 0.0 | AK066659.1 Oryza sativa Japonica Group cDNA clone:J013068K17, full insert sequence. | |||
| GenBank | AP003251 | 0.0 | AP003251.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0446B05. | |||
| GenBank | AP014957 | 0.0 | AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012609 | 0.0 | CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025878116.1 | 8e-96 | transcription factor PCL1-like | ||||
| Swissprot | Q9SNB4 | 3e-30 | PCL1_ARATH; Transcription factor LUX | ||||
| TrEMBL | A0A0D3EW58 | 4e-97 | A0A0D3EW58_9ORYZ; Uncharacterized protein | ||||
| STRING | OBART01G37040.1 | 6e-98 | (Oryza barthii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1620 | 34 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G05090.1 | 3e-30 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




