![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OBART02G09820.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | BES1 | ||||||||
| Protein Properties | Length: 96aa MW: 10948.8 Da PI: 10.2918 | ||||||||
| Description | BES1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF822 | 121 | 1.7e-37 | 33 | 85 | 20 | 72 |
DUF822 20 RrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkg 72
RrRRaiaakiyaGLRa+Gny lpk++DnneVlkALc+eAGw+ve+DGttyrk
OBART02G09820.1 33 RRRRAIAAKIYAGLRAYGNYTLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKV 85
9**************************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05687 | 1.6E-36 | 32 | 89 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MPHLPSPAQD HPGVEWSLRV LRPLLLLRRI YTRRRRAIAA KIYAGLRAYG NYTLPKHCDN 60 NEVLKALCNE AGWTVEPDGT TYRKVPLPHP LLLLAN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zd4_A | 3e-22 | 37 | 88 | 391 | 444 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_B | 3e-22 | 37 | 88 | 391 | 444 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_C | 3e-22 | 37 | 88 | 391 | 444 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_D | 3e-22 | 37 | 88 | 391 | 444 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May function in brassinosteroid signaling. {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00474 | DAP | Transfer from AT4G36780 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP004070 | 1e-103 | AP004070.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1705_E12. | |||
| GenBank | AP014958 | 1e-103 | AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015688525.1 | 2e-30 | PREDICTED: protein BZR1 homolog 4 | ||||
| Swissprot | Q6EUF1 | 2e-29 | BZR4_ORYSJ; Protein BZR1 homolog 4 | ||||
| TrEMBL | A0A0D3F2U2 | 2e-63 | A0A0D3F2U2_9ORYZ; Uncharacterized protein | ||||
| STRING | OBART02G09820.1 | 3e-64 | (Oryza barthii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1366 | 38 | 112 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G36780.1 | 2e-24 | BES1/BZR1 homolog 2 | ||||




