PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OBART07G19930.1

Organism

Oryza barthii

Taxonomic ID

65489

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

BES1

Protein Properties

Length: 207aa MW: 22012.5 Da PI: 5.266

Description

BES1 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OBART07G19930.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF822	29.6	2.3e-09	2	56	89	145
DUF822 89 spesslq.sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145 sp+ss+q +s+ ss+++spv+sy+asp+sssfpsps++d+ s+ ++llp+l+ l++ OBART07G19930.1 2 SPCSSTQlLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSA---SCLLPFLRGLPN 56 89***9****************************99866...588888876665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF05687	2.5E-6	1	41	IPR008540	BES1/BZR1 plant transcription factor, N-terminal

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009742	Biological Process	brassinosteroid mediated signaling pathway
GO:0042742	Biological Process	defense response to bacterium
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0005829	Cellular Component	cytosol
GO:0001046	Molecular Function	core promoter sequence-specific DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 207 aa Download sequence Send to blast
MSPCSSTQLL SAPSSSFPSP VPSYHASPAS SSFPSPSRID NPSASCLLPF LRGLPNLPPL 60 RVSSSAPVTP PLSSPTASRP PKIRKPDWDV DPFRHPFFAV SAPASPTRGR RLEHPDTIPE 120 CDESDVSTVD SGRWISFQMA TTAPTSPTYN LVNPGASTSN SMEIEGTAGR GGAEFEFDKG 180 RVTPWEGERI HEVAAEELEL TLGVGAK

Functional Description ? help Back to Top
Source	Description
UniProt	Positive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid biosynthetic genes. May act as transcriptional repressor by binding the brassinosteroid-response element (5'-CGTGCG-3') in the promoter of GRAS32 (AC Q9LWU9), another positive regulator of brassinosteroid signaling (By similarity). {ECO:0000250}.
UniProt	Positive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid (BR) biosynthetic genes (PubMed:17699623, PubMed:19220793). May act as transcriptional repressor by binding the brassinosteroid-response element (BREE) (5'-CGTG(T/C)G-3') in the promoter of DLT (AC Q9LWU9), another positive regulator of BR signaling (PubMed:19220793). Acts as transcriptional repressor of LIC, a negative regulator of BR signaling, by binding to the BRRE element of its promoter. BZR1 and LIC play opposite roles in BR signaling and regulation of leaf bending (PubMed:22570626). {ECO:0000269\|PubMed:17699623, ECO:0000269\|PubMed:19220793, ECO:0000269\|PubMed:22570626}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00073	ChIP-chip	Transfer from AT1G19350	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269\|PubMed:22570626}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK106748	0.0	AK106748.1 Oryza sativa Japonica Group cDNA clone:002-115-C06, full insert sequence.
GenBank	AP004276	0.0	AP004276.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0453G03.
GenBank	AP014963	0.0	AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBank	CP012615	0.0	CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015645123.1	1e-145	protein BZR1 homolog 1
Swissprot	B8B7S5	1e-146	BZR1_ORYSI; Protein BZR1 homolog 1
Swissprot	Q7XI96	1e-146	BZR1_ORYSJ; Protein BZR1 homolog 1
TrEMBL	A0A0D3GST1	1e-145	A0A0D3GST1_9ORYZ; Uncharacterized protein
TrEMBL	A0A0E0I2U3	1e-144	A0A0E0I2U3_ORYNI; Uncharacterized protein
TrEMBL	A0A0E0QAC1	1e-144	A0A0E0QAC1_ORYRU; Uncharacterized protein
TrEMBL	I1QEM4	1e-144	I1QEM4_ORYGL; Uncharacterized protein
STRING	ORUFI07G20760.1	1e-145	(Oryza rufipogon)
STRING	ONIVA07G18390.1	1e-145	(Oryza nivara)
STRING	ORGLA07G0256600.1	1e-145	(Oryza glaberrima)
STRING	OBART07G19930.1	1e-145	(Oryza barthii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5474	34	53

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G19350.3	2e-49	BES1 family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Tong H, et al. DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice. Plant Cell, 2012. 24(6): p. 2562-77 [PMID:22685166]