PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OBART08G17810.1

Organism

Oryza barthii

Taxonomic ID

65489

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

bZIP

Protein Properties

Length: 144aa MW: 15736 Da PI: 10.696

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OBART08G17810.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	51.1	3e-16	69	112	5	48
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++N++L+k+ OBART08G17810.1 69 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNMELQKK 112 79***************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.1E-12	65	131	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.944	67	112	IPR004827	Basic-leucine zipper domain
CDD	cd14707	3.15E-23	69	115	No hit	No description
Gene3D	G3DSA:1.20.5.170	1.3E-15	69	112	No hit	No description
SuperFamily	SSF57959	1.69E-11	69	112	No hit	No description
Pfam	PF00170	1.1E-13	69	112	IPR004827	Basic-leucine zipper domain
PROSITE pattern	PS00036	0	72	87	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 144 aa Download sequence Send to blast
MGNGLMSGVA GIGGGAITVA PVDTSVGQMD SAGKGDGDLS SPMAPVPYPF EGVIRGRRSG 60 GNVEKVVERR QRRMIKNRES AARSRARKQA YTMELEAEVQ KLKEQNMELQ KKQVLEAVNN 120 PYGQKKRCLR RTLTGPWNVG EIHI

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269\|PubMed:10611387}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA). {ECO:0000269\|PubMed:10611387}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB023288	0.0	AB023288.1 Oryza sativa Japonica Group mRNA for TRAB1, complete cds.
GenBank	AY323482	0.0	AY323482.1 Oryza sativa (japonica cultivar-group) bZIP transcription factor (aba1) mRNA, complete cds.
GenBank	KT037117	0.0	KT037117.1 Oryza sativa Indica Group cultivar Nonabokra abscisic acid inducible bZIP protein (TRAB1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015650926.1	2e-78	bZIP transcription factor TRAB1
Swissprot	Q6ZDF3	2e-79	TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBL	A0A0D3H1A0	1e-100	A0A0D3H1A0_9ORYZ; Uncharacterized protein
TrEMBL	A0A0E0ID92	6e-98	A0A0E0ID92_ORYNI; Uncharacterized protein
STRING	ONIVA08G19830.1	1e-98	(Oryza nivara)
STRING	OBART08G17810.1	1e-101	(Oryza barthii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP706	38	147

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G19290.1	3e-37	ABRE binding factor 4

Publications ? help Back to Top
Kagaya Y,Hobo T,Murata M,Ban A,Hattori T Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1. Plant Cell, 2002. 14(12): p. 3177-89 [PMID:12468735] Kobayashi Y, et al. Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors. Plant J., 2005. 44(6): p. 939-49 [PMID:16359387] Kobayashi F,Maeta E,Terashima A,Takumi S Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings. Physiol Plant, 2008. 134(1): p. 74-86 [PMID:18433415]