![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OBART10G17410.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 96aa MW: 10045.1 Da PI: 10.562 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 35.2 | 2.2e-11 | 52 | 96 | 2 | 46 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHH CS
Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkv 46
rk+ +++k+q +Le+ F+k+++++ ++++ LA++l+L+ rqV v
OBART10G17410.1 52 RKKLRLSKDQAAVLEDTFNKHNTLNPKQKAALARQLNLKPRQVEV 96
788899*************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04618 | 7.4E-7 | 7 | 31 | IPR006712 | HD-ZIP protein, N-terminal |
| SuperFamily | SSF46689 | 3.04E-10 | 37 | 96 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-12 | 39 | 96 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 10.009 | 48 | 96 | IPR001356 | Homeobox domain |
| Pfam | PF00046 | 8.7E-9 | 52 | 96 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 1.00E-9 | 52 | 96 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
LDHPAAARRS GEPAVSSPNS TLSSLSGKRG VPSTAAAAVG GSDDEDSGDG SRKKLRLSKD 60 QAAVLEDTFN KHNTLNPKQK AALARQLNLK PRQVEV |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 50 | 56 | SRKKLRL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription repressor involved leaf development. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. May act as a regulatory switch to specify provascular cell fate. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:10934011, ECO:0000269|PubMed:9076993}. | |||||
| UniProt | Probable transcription repressor involved leaf development. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. May act as a regulatory switch to specify provascular cell fate. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:9076993}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin and sucrose in primary root apical region. By wounding in leaves. {ECO:0000269|PubMed:10732669}. | |||||
| UniProt | INDUCTION: By auxin and sucrose in primary root apical region. By wounding in leaves. {ECO:0000269|PubMed:10934011}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK065404 | 3e-96 | AK065404.1 Oryza sativa Japonica Group cDNA clone:J013006I17, full insert sequence. | |||
| GenBank | CT832944 | 3e-96 | CT832944.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA107F07, full insert sequence. | |||
| GenBank | CT832945 | 3e-96 | CT832945.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA120M16, full insert sequence. | |||
| GenBank | X96681 | 3e-96 | X96681.2 Oryza sativa mRNA for DNA-binding protein (Oshox1 gene). | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002467488.1 | 9e-35 | homeobox-leucine zipper protein HOX1 | ||||
| Swissprot | Q40691 | 1e-32 | HOX1_ORYSI; Homeobox-leucine zipper protein HOX1 | ||||
| Swissprot | Q7XC54 | 1e-32 | HOX1_ORYSJ; Homeobox-leucine zipper protein HOX1 | ||||
| TrEMBL | A0A0D3HG73 | 3e-61 | A0A0D3HG73_9ORYZ; Uncharacterized protein | ||||
| STRING | OBART10G17410.1 | 5e-62 | (Oryza barthii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2587 | 38 | 89 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G06710.1 | 1e-19 | homeobox from Arabidopsis thaliana | ||||




