![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OBART11G19180.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 100aa MW: 10867.4 Da PI: 7.3656 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 28.3 | 3.1e-09 | 23 | 62 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
++ + +++L+ +lP++ ++ + K s ae+L++A++YI+ L
OBART11G19180.1 23 QMAELISKLQAVLPTRGGEANAKASSAEVLQEACRYIRRL 62
78899**********88*********************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50888 | 8.55 | 8 | 62 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 2.09E-8 | 22 | 78 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 4.1E-6 | 23 | 62 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 1.5E-7 | 23 | 65 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
MSSSRRSRTS SRLAAAPPPT DEQMAELISK LQAVLPTRGG EANAKASSAE VLQEACRYIR 60 RLHREADALS ERLAELLLLQ PSDLAINGAD VPDLIRSLLM |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT833202 | 1e-169 | CT833202.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA029D09, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015616701.1 | 5e-64 | transcription factor ILI2 isoform X2 | ||||
| Swissprot | B8BLA3 | 9e-55 | ILI2_ORYSI; Transcription factor ILI2 | ||||
| Swissprot | Q2R1J3 | 9e-55 | ILI2_ORYSJ; Transcription factor ILI2 | ||||
| TrEMBL | A0A0D3HNS7 | 1e-62 | A0A0D3HNS7_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A0A0E0HS14 | 1e-62 | A0A0E0HS14_ORYNI; Uncharacterized protein | ||||
| STRING | ONIVA06G20810.1 | 2e-63 | (Oryza nivara) | ||||
| STRING | OBART11G19180.1 | 2e-63 | (Oryza barthii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP17004 | 11 | 12 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G39860.1 | 8e-11 | bHLH family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




