PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OGLUM02G26080.1

Organism

Oryza glumaepatula

Taxonomic ID

40148

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

TCP

Protein Properties

Length: 83aa MW: 9567.05 Da PI: 12.2635

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OGLUM02G26080.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	91.3	2e-28	34	83	3	52
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLl 52 +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG++++++t++WLl OGLUM02G26080.1 34 PKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSNGETVQWLL 83 6999*********************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	2.1E-23	38	83	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	23.463	39	83	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 83 aa Download sequence Send to blast
MRAHAARERI RYQQQQMQVA AAVTGERRMQ GLGPKRSSNK DRHTKVDGRG RRIRMPALCA 60 ARIFQLTREL GHKSNGETVQ WLL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269\|PubMed:12631321, ECO:0000269\|PubMed:16123132}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP004133	1e-118	AP004133.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1112_G03.
GenBank	AP004768	1e-118	AP004768.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0010C01.
GenBank	AP014958	1e-118	AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015624510.2	3e-40	LOW QUALITY PROTEIN: transcription factor TCP20
Swissprot	Q9LSD5	2e-29	TCP20_ARATH; Transcription factor TCP20
TrEMBL	A0A0D9YVK1	9e-54	A0A0D9YVK1_9ORYZ; Uncharacterized protein
STRING	OGLUM02G26080.1	1e-54	(Oryza glumipatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2864	32	69

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27010.1	5e-30	TCP family protein

Publications ? help Back to Top
Zhu P, et al. Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972 [PMID:27708161] Wu JF, et al. LWD-TCP complex activates the morning gene CCA1 in Arabidopsis. Nat Commun, 2016. 7: p. 13181 [PMID:27734958] Guan P, et al. Interacting TCP and NLP transcription factors control plant responses to nitrate availability. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424 [PMID:28202720] Guan P Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis. Front Plant Sci, 2017. 8: p. 1697 [PMID:29033968] Zhang N, et al. MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis. Plant J., 2018. 93(1): p. 66-78 [PMID:29086441] Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development. Plant Physiol., 2018. 176(2): p. 1694-1708 [PMID:29133375] Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis. Microbes Environ., 2017. 32(4): p. 314-323 [PMID:29187692]