![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OGLUM03G06890.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 74aa MW: 7916.98 Da PI: 8.103 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 34.8 | 5.7e-11 | 34 | 74 | 5 | 45 |
TCP 5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkds 45
k ++++ h+kv+ + R+R+ + a +F+L +eLG+++d+
OGLUM03G06890.1 34 KPPSKDCHSKVDTLGCRIRMHIIYTAHIFQLNRELGHKSDG 74
8899***********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51369 | 9.302 | 37 | 74 | IPR017887 | Transcription factor TCP subgroup |
| Pfam | PF03634 | 7.9E-8 | 37 | 74 | IPR005333 | Transcription factor, TCP |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MTKVHGDGGG GAALDKQLVP DASNDNGTAF AICKPPSKDC HSKVDTLGCR IRMHIIYTAH 60 IFQLNRELGH KSDG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the regulation of the circadian clock. Acts as a repressor of CCA1 by binding to its promoter. No binding to the LHY promoter. {ECO:0000269|PubMed:19286557}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC210480 | 3e-95 | AC210480.2 Oryza glaberrima clone OG_BBa0067M08, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015629543.1 | 1e-22 | transcription factor TCP21 | ||||
| Swissprot | Q9FTA2 | 2e-14 | TCP21_ARATH; Transcription factor TCP21 | ||||
| TrEMBL | A0A0D9Z3C0 | 5e-48 | A0A0D9Z3C0_9ORYZ; Uncharacterized protein | ||||
| STRING | OGLUM03G06890.1 | 8e-49 | (Oryza glumipatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP38180 | 3 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G08330.1 | 7e-17 | TCP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




