![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OGLUM05G20580.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 109aa MW: 12612.7 Da PI: 8.0361 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 152.7 | 6.9e-48 | 1 | 80 | 17 | 96 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
mkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+kyre+e++
OGLUM05G20580.1 1 MKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYREMEEA 80
9****************************************************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.6E-43 | 1 | 90 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 8.4E-22 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 3.55E-32 | 1 | 80 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 4.5E-23 | 19 | 37 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.5E-23 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 4.5E-23 | 57 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MKKAIPANGK IAKDAKETVQ ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF 60 EDYIEPLKVY LQKYREMEEA VQVPKGWANK QHTIKEWVIC NLRIFLLAM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 3e-40 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 3e-40 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB095439 | 1e-128 | AB095439.1 Oryza sativa Japonica Group OsHAP3B mRNA for HAP3, partial cds. | |||
| GenBank | AK100811 | 1e-128 | AK100811.1 Oryza sativa Japonica Group cDNA clone:J023121O11, full insert sequence. | |||
| GenBank | AY224530 | 1e-128 | AY224530.1 Oryza sativa (japonica cultivar-group) isolate 21744 CCAAT-binding transcription factor-like protein mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015639303.1 | 1e-52 | nuclear transcription factor Y subunit B-3 | ||||
| Refseq | XP_015639304.1 | 1e-52 | nuclear transcription factor Y subunit B-3 | ||||
| Refseq | XP_015639305.1 | 1e-52 | nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | Q60EQ4 | 1e-53 | NFYB3_ORYSJ; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | A0A0E0A0D4 | 2e-75 | A0A0E0A0D4_9ORYZ; Uncharacterized protein | ||||
| STRING | OGLUM05G20580.1 | 3e-76 | (Oryza glumipatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 7e-51 | nuclear factor Y, subunit B8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




