PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM09G04670.5
Organism
Oryza glumaepatula
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 167aa    MW: 17763.7 Da    PI: 7.4067
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM09G04670.5genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY90.61.2e-28105157254
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYeg 54 
                      d g++WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+ +d+++v++tY g
  OGLUM09G04670.5 105 DAGFRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERALHDTRAVITTYAG 157
                      569************************************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575124No hitNo description
Gene3DG3DSA:2.20.25.804.0E-2886157IPR003657WRKY domain
PROSITE profilePS5081130.11399164IPR003657WRKY domain
SuperFamilySSF1182901.14E-23100157IPR003657WRKY domain
SMARTSM007747.8E-30104163IPR003657WRKY domain
PfamPF031067.2E-21107157IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006885Biological Processregulation of pH
GO:0035725Biological Processsodium ion transmembrane transport
GO:1902600Biological Processhydrogen ion transmembrane transport
GO:0005768Cellular Componentendosome
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0015385Molecular Functionsodium:proton antiporter activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MPLRAGSRPV LRNTPSGCAA AAACADQYSA ATPDNSSVTF GDDEADNESH SSEGYEPEAK  60
CWKEDADNEG SSGGMGGGAG GKPVRKPRLV VHTLSDIDIN IDILDAGFRW RKYGQKVVKG  120
NPNPRSYYKC TTVGCPVRKH VERALHDTRA VITTYAGAVV QRDPAVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-261011651478Probable WRKY transcription factor 4
2lex_A2e-261011651478Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}.
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}.
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1904361e-147AB190436.1 Oryza sativa Japonica Group OsWRKY53 mRNA for transcription factor OsWRKY53, complete cds.
GenBankAK1211901e-147AK121190.1 Oryza sativa Japonica Group cDNA clone:J023086B03, full insert sequence.
GenBankAY6769291e-147AY676929.1 Oryza sativa (indica cultivar-group) transcription factor WRKY53 (WRKY53) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640378.12e-66probable WRKY transcription factor 26 isoform X2
SwissprotQ6B6R42e-45WRK24_ORYSI; WRKY transcription factor WRKY24
SwissprotQ6IEQ72e-45WRK24_ORYSJ; WRKY transcription factor WRKY24
TrEMBLA0A0E0B0V31e-120A0A0E0B0V3_9ORYZ; Uncharacterized protein
STRINGOGLUM09G04670.11e-116(Oryza glumipatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.13e-36WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang ZL, et al.
    A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.
    Plant Mol. Biol., 2009. 70(1-2): p. 139-51
    [PMID:19199048]
  3. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]
  4. Zhang L, et al.
    Three WRKY transcription factors additively repress abscisic acid and gibberellin signaling in aleurone cells.
    Plant Sci., 2015. 236: p. 214-22
    [PMID:26025535]