PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OMERI01G15230.4

Organism

Oryza meridionalis

Taxonomic ID

40149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

NAC

Protein Properties

Length: 65aa MW: 7388.29 Da PI: 4.1789

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OMERI01G15230.4	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	55.5	1.9e-17	14	61	1	48
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 lppGfrFhPtdee++++yL++kv +++ + +i evd++k+ePwdLp OMERI01G15230.4 14 LPPGFRFHPTDEEIITFYLAPKVVDSRGFCVAAIGEVDLNKCEPWDLP 61 79******************99999556588************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.01E-18	10	62	IPR003441	NAC domain
PROSITE profile	PS51005	20.461	14	65	IPR003441	NAC domain
Pfam	PF02365	5.2E-8	15	58	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
MGEQQQQVER QPDLPPGFRF HPTDEEIITF YLAPKVVDSR GFCVAAIGEV DLNKCEPWDL 60 PASDR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:21303842}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269\|PubMed:21303842}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK107407	7e-96	AK107407.1 Oryza sativa Japonica Group cDNA clone:002-127-E05, full insert sequence.
GenBank	AP004610	7e-96	AP004610.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1109A06.
GenBank	AP014957	7e-96	AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBank	CP012609	7e-96	CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBank	EU846995	7e-96	EU846995.1 Oryza sativa Japonica Group clone KCS259A08 NAC protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015621005.1	3e-38	NAC domain-containing protein 79
Swissprot	Q9LJW3	6e-21	NAC59_ARATH; NAC domain-containing protein 59
TrEMBL	A0A0E0C2B7	4e-41	A0A0E0C2B7_9ORYZ; Uncharacterized protein
STRING	OGLUM01G00350.1	2e-37	(Oryza glumipatula)
STRING	OS01T0104500-01	1e-37	(Oryza sativa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G29035.1	3e-23	NAC domain containing protein 3

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]