PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OMERI03G23890.1

Organism

Oryza meridionalis

Taxonomic ID

40149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

NAC

Protein Properties

Length: 319aa MW: 34173.6 Da PI: 6.3624

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OMERI03G23890.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	179.3	1e-55	5	130	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrFhPtdeelv++yL++kv++ + + ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++ OMERI03G23890.1 5 LPPGFRFHPTDEELVTYYLARKVSDFGFAT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEIFH 97 79***********************999.89***********999999************************************ PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 +g+l g+kktLvfy+grapkg kt+Wvmheyrl OMERI03G23890.1 98 -GGALAGMKKTLVFYRGRAPKGAKTSWVMHEYRL 130 .*****************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.79E-65	3	151	IPR003441	NAC domain
PROSITE profile	PS51005	60.377	5	151	IPR003441	NAC domain
Pfam	PF02365	4.4E-29	6	130	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 319 aa Download sequence Send to blast
MEEGLPPGFR FHPTDEELVT YYLARKVSDF GFATRAIADV DLNKCEPWDL PSKASMGEKE 60 WYFFSMRDRK YPTGIRTNRA TDSGYWKTTG KDKEIFHGGA LAGMKKTLVF YRGRAPKGAK 120 TSWVMHEYRL QSKFPYKPAK DEWVVCRVFK KLCNLARPPR QSLDDDVAAD GASPPEMVDA 180 ELGELDVSSI LLGGGGSFAP LPSGALCHGG GDGFGAYMSW LQAAAAANQG MFQWPAATQA 240 GLLGGTVFAA AHKAAGTMPF GGGCSQQQAR DVGVSLANVG GGGGGGDALF GGAPLAKVDM 300 ECGEQAPQLD MDDSTWRAF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-56	4	151	16	165	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-56	4	151	16	165	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-56	4	151	16	165	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-56	4	151	16	165	NO APICAL MERISTEM PROTEIN
4dul_A	1e-56	4	151	16	165	NAC domain-containing protein 19
4dul_B	1e-56	4	151	16	165	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269\|PubMed:15295076, ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:21303842, ECO:0000269\|PubMed:23340744, ECO:0000269\|PubMed:23459204, ECO:0000269\|PubMed:9351240}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00364	DAP	Transfer from AT3G18400	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19608714, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:20404534, ECO:0000269\|PubMed:21511905, ECO:0000269\|PubMed:22930749}.
UniProt	INDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:17098808, ECO:0000269\|PubMed:18305205, ECO:0000305\|PubMed:15723790}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK062675	0.0	AK062675.1 Oryza sativa Japonica Group cDNA clone:001-105-G11, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015629240.1	0.0	NAC domain-containing protein 79
Swissprot	Q9FKA0	3e-77	NAC92_ARATH; NAC domain-containing protein 92
Swissprot	Q9FLR3	3e-77	NAC79_ARATH; NAC domain-containing protein 79
TrEMBL	A0A0E0D3U4	0.0	A0A0E0D3U4_9ORYZ; Uncharacterized protein
STRING	OS03T0624600-01	0.0	(Oryza sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP7919	34	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G18400.1	3e-92	NAC domain containing protein 58

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Khan M,Rozhon W,Poppenberger B The role of hormones in the aging of plants - a mini-review. Gerontology, 2014. 60(1): p. 49-55 [PMID:24135638] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vidal EA,Álvarez JM,Gutiérrez RA Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function. Plant Signal Behav, 2014. 9(3): p. e28501 [PMID:24642706] Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast. Plant J., 2015. 81(3): p. 377-87 [PMID:25440717] Lee MH,Jeon HS,Kim HG,Park OK An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164. New Phytol., 2017. 214(1): p. 343-360 [PMID:28032643] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Kim H, et al. Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453 [PMID:30065116]