PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G23060.1
Organism
Oryza meridionalis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 197aa    MW: 21267.4 Da    PI: 4.8819
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G23060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY85.16.7e-2798152155
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYege 55 
                      ldD + WrKYGqK+vkg+++prsYY+Ct+ gC+v  +ver+++d+++v++tY g 
  OMERI04G23060.1  98 LDDSFPWRKYGQKVVKGNPNPRSYYKCTTVGCSVWNHVERASHDTRAVITTYAGA 152
                      58**************************************************995 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.5E-2685152IPR003657WRKY domain
SuperFamilySSF1182901.57E-2293151IPR003657WRKY domain
PROSITE profilePS5081128.9293158IPR003657WRKY domain
SMARTSM007744.6E-2698158IPR003657WRKY domain
PfamPF031062.3E-1899151IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MPLWAGSLST RRNTSSGCAA AAACADQYSA ATPDNSSVTF GDDEADNESH RNKGDEPEAK  60
GCKEDADNEG SSDGMGAGAD GKPRLVVHTL SDINIDILDD SFPWRKYGQK VVKGNPNPRS  120
YYKCTTVGCS VWNHVERASH DTRAVITTYA GAVVQHDPAG PYTLEMFPNP ACLYGITAFQ  180
RTKDKPRDDL FVESLLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-2487151870Probable WRKY transcription factor 4
2lex_A4e-2487151870Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}.
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}.
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1904361e-101AB190436.1 Oryza sativa Japonica Group OsWRKY53 mRNA for transcription factor OsWRKY53, complete cds.
GenBankAK1211901e-101AK121190.1 Oryza sativa Japonica Group cDNA clone:J023086B03, full insert sequence.
GenBankAY6769291e-101AY676929.1 Oryza sativa (indica cultivar-group) transcription factor WRKY53 (WRKY53) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640378.11e-69probable WRKY transcription factor 26 isoform X2
SwissprotQ6B6R44e-40WRK24_ORYSI; WRKY transcription factor WRKY24
SwissprotQ6IEQ74e-40WRK24_ORYSJ; WRKY transcription factor WRKY24
TrEMBLA0A0E0DJ891e-146A0A0E0DJ89_9ORYZ; Uncharacterized protein
STRINGOMERI04G22600.28e-98(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP230046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.15e-28WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang ZL, et al.
    A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.
    Plant Mol. Biol., 2009. 70(1-2): p. 139-51
    [PMID:19199048]
  3. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]
  4. Zhang L, et al.
    Three WRKY transcription factors additively repress abscisic acid and gibberellin signaling in aleurone cells.
    Plant Sci., 2015. 236: p. 214-22
    [PMID:26025535]