![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OMERI05G05890.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 103aa MW: 11079.5 Da PI: 8.2071 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 67.4 | 1.4e-21 | 50 | 87 | 14 | 51 |
HHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 14 skRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
+kRrng+lKKA+ELS Cdaeva+i+fss+g+lyeys+
OMERI05G05890.1 50 IKRRNGLLKKAYELSMICDAEVALIVFSSRGHLYEYSN 87
69**********************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 19.385 | 40 | 89 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 5.7E-17 | 43 | 88 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.35E-17 | 45 | 89 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.6E-18 | 51 | 66 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.9E-17 | 51 | 85 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.6E-18 | 66 | 87 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MHIYNEQEAE PSTGLMMPEP APAASPGSGS SGGSGSVGAE KSGSRGKIEI KRRNGLLKKA 60 YELSMICDAE VALIVFSSRG HLYEYSNNRY CIPLPLFSSR NLN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269|PubMed:16326928}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC135920 | 3e-71 | AC135920.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0015G13, complete sequence. | |||
| GenBank | AP014961 | 3e-71 | AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012613 | 3e-71 | CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025881631.1 | 6e-35 | MADS-box transcription factor 58 isoform X2 | ||||
| Swissprot | Q2V0P1 | 1e-36 | MAD58_ORYSJ; MADS-box transcription factor 58 | ||||
| TrEMBL | A0A0E0DN62 | 3e-68 | A0A0E0DN62_9ORYZ; Uncharacterized protein | ||||
| STRING | OMERI05G05680.1 | 4e-69 | (Oryza meridionalis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.2 | 2e-20 | MIKC_MADS family protein | ||||




