PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OMERI07G02330.2

Organism

Oryza meridionalis

Taxonomic ID

40149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

YABBY

Protein Properties

Length: 134aa MW: 14606.3 Da PI: 6.9297

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OMERI07G02330.2	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	95.1	1.6e-29	1	70	1	73
YABBY 1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelle 73 ++v+++se+vCyv+Cn+Cntil+v+vP+++++++vtvrCGhCt++ls++la ++q++++++h + e++ OMERI07G02330.2 1 MSVQFTSEHVCYVNCNYCNTILVVNVPNNCSYNIVTVRCGHCTMVLSMDLAPFHQARTVQDHQKS---EDINS 70 57999********************************************************9433...33333 PP
2	YABBY	73.5	7.3e-23	82	122	130	170
YABBY 130 nrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 + eeiqrik+snP+ishreafsaaaknWah+P++hfgl OMERI07G02330.2 82 VTYTSEEIQRIKTSNPEISHREAFSAAAKNWAHLPRLHFGL 122 46789**********************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.6E-21	6	71	IPR006780	YABBY protein
Pfam	PF04690	1.2E-19	83	122	IPR006780	YABBY protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010158	Biological Process	abaxial cell fate specification
GO:0048833	Biological Process	specification of floral organ number
GO:0005634	Cellular Component	nucleus

Sequence ? help Back to Top
Protein Sequence Length: 134 aa Download sequence Send to blast
MSVQFTSEHV CYVNCNYCNT ILVVNVPNNC SYNIVTVRCG HCTMVLSMDL APFHQARTVQ 60 DHQKSEDINS HVPNANQSAA SVTYTSEEIQ RIKTSNPEIS HREAFSAAAK NWAHLPRLHF 120 GLSVADGGGG GGSN

Functional Description ? help Back to Top
Source	Description
UniProt	May play a role in floral meristem development and maintenance of stamens, rather than in determining polarity in floral organs. {ECO:0000269\|PubMed:15604733, ECO:0000269\|PubMed:17369428}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB274013	1e-101	AB274013.1 Oryza sativa Japonica Group OsYABBY1 mRNA for OsYABBY1 protein, complete cds.
GenBank	AF098752	1e-101	AF098752.1 Oryza sativa clone FIL1 unknown mRNA.
GenBank	AK070045	1e-101	AK070045.1 Oryza sativa Japonica Group cDNA clone:J023038F18, full insert sequence.
GenBank	AK100222	1e-101	AK100222.1 Oryza sativa Japonica Group cDNA clone:J023047G10, full insert sequence.
GenBank	CT828681	1e-101	CT828681.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA230C13, full insert sequence.
GenBank	CT828682	1e-101	CT828682.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA240F12, full insert sequence.
GenBank	CT828683	1e-101	CT828683.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA249C03, full insert sequence.
GenBank	CT828684	1e-101	CT828684.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN084I04, full insert sequence.
GenBank	CT832577	1e-101	CT832577.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA333Z37, full insert sequence.
GenBank	FJ750932	1e-101	FJ750932.1 Oryza sativa clone KCS005G02 MADS-box transcription factor mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006657460.1	3e-69	PREDICTED: protein YABBY 1
Swissprot	Q7XIM7	3e-69	YAB1_ORYSJ; Protein YABBY 1
TrEMBL	A0A0E0E7N1	4e-96	A0A0E0E7N1_9ORYZ; Uncharacterized protein
STRING	LPERR07G03250.1	5e-74	(Leersia perrieri)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08465.1	2e-37	YABBY family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Ohmori Y,Abiko M,Horibata A,Hirano HY A transposon, Ping, is integrated into intron 4 of the DROOPING LEAF gene of rice, weakly reducing its expression and causing a mild drooping leaf phenotype. Plant Cell Physiol., 2008. 49(8): p. 1176-84 [PMID:18593744] Ohmori Y,Toriba T,Nakamura H,Ichikawa H,Hirano HY Temporal and spatial regulation of DROOPING LEAF gene expression that promotes midrib formation in rice. Plant J., 2011. 65(1): p. 77-86 [PMID:21175891] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Tanaka W, et al. The YABBY gene TONGARI-BOUSHI1 is involved in lateral organ development and maintenance of meristem organization in the rice spikelet. Plant Cell, 2012. 24(1): p. 80-95 [PMID:22286138] Yang C,Ma Y,Li J The rice YABBY4 gene regulates plant growth and development through modulating the gibberellin pathway. J. Exp. Bot., 2016. 67(18): p. 5545-5556 [PMID:27578842]