PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OMERI08G13100.1

Organism

Oryza meridionalis

Taxonomic ID

40149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MYB

Protein Properties

Length: 254aa MW: 27286.3 Da PI: 9.9305

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OMERI08G13100.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.8	3.9e-16	83	128	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed +l ++v+++G+ +W++Ia ++ gR++k+c++rw++ OMERI08G13100.1 83 RGHWRPAEDAKLRELVALYGPQNWNLIADKLD-GRSGKSCRLRWFNQ 128 899***************************.*********996 PP
2	Myb_DNA-binding	53	8.1e-17	136	178	2	46
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +++ eE+e+l a++ +G++ W+ Iar ++ gRt++ +k++w+ OMERI08G13100.1 136 RPFSDEEEERLMAAHRFYGNK-WAMIARLFP-GRTDNAVKNHWHV 178 68*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.599	78	129	IPR017930	Myb domain
SMART	SM00717	9.9E-14	82	131	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-15	83	128	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.99E-28	83	176	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.1E-25	84	136	IPR009057	Homeodomain-like
CDD	cd00167	4.91E-12	86	127	No hit	No description
PROSITE profile	PS51294	24.91	130	184	IPR017930	Myb domain
SMART	SM00717	4.9E-13	134	182	IPR001005	SANT/Myb domain
Pfam	PF00249	4.8E-13	135	177	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.5E-20	137	183	IPR009057	Homeodomain-like
CDD	cd00167	8.49E-10	137	177	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 254 aa Download sequence Send to blast
MPCSSAAWML HVGAAATEQA SSSSSSKGGG RVVTAGTTTM DTGGYNNGGG GGGGGGNGGG 60 GGDHQESSSS GGGGGQSSRL AARGHWRPAE DAKLRELVAL YGPQNWNLIA DKLDGRSGKS 120 CRLRWFNQLD PRISKRPFSD EEEERLMAAH RFYGNKWAMI ARLFPGRTDN AVKNHWHVIM 180 ARKYREQSTA YRRRKLNQAV QRKLDATTAA AADDDVVVAH HPYAFSFRHY CFPFPAASPA 240 AADEPPFTCL FPGK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-32	82	183	6	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269\|PubMed:20305120}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding. {ECO:0000269\|PubMed:20305120}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP012616	0.0	CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025883218.1	1e-119	transcription factor CSA-like isoform X1
Swissprot	Q5NBM8	6e-72	CSA_ORYSJ; Transcription factor CSA
TrEMBL	A0A0E0ELX0	0.0	A0A0E0ELX0_9ORYZ; Uncharacterized protein
STRING	OMERI08G12810.1	0.0	(Oryza meridionalis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP294	38	260

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69560.1	2e-71	myb domain protein 105

Publications ? help Back to Top
Leonard LM,Follette VM Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications. Annu Rev Sex Res, 2002. 13: p. 346-88 [PMID:12836736] Wang L,Li X,Chen Z Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities. Int. J. Biol. Macromol., 2009. 44(2): p. 211-4 [PMID:19135473] Wang L,Huang H,Wei Y,Li X,Chen Z Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran. Int. J. Biol. Macromol., 2009. 45(4): p. 427-31 [PMID:19549538] Zhang H, et al. Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development. Plant Cell, 2010. 22(3): p. 672-89 [PMID:20305120] Zhang H, et al. Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81 [PMID:23256151] Zhu X, et al. Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein. Plant J., 2015. 82(4): p. 570-81 [PMID:25754973] Li X, et al. Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress. Plant Cell Environ., 2015. 38(10): p. 2171-92 [PMID:25828772] Shaar-Moshe L,Hübner S,Peleg Z Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach. BMC Plant Biol., 2015. 15: p. 111 [PMID:25935420]