![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OMERI10G06290.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 131aa MW: 14670.7 Da PI: 10.5208 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 77.2 | 3e-24 | 25 | 81 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
dep+YVNaKQy++I++RRq+R+ + +e+k+ ++ rk++l+e+R+k+A+ R+Rg+gGrF
OMERI10G06290.1 25 DEPIYVNAKQYHAIIRRRQRRKIVGSEDKV-AAIRKRILFEARQKQAKLRRRGKGGRF 81
79****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 8.8E-18 | 23 | 84 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 22.52 | 24 | 84 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 6.9E-17 | 26 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 8.7E-14 | 27 | 49 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 8.7E-14 | 58 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 131 aa Download sequence Send to blast |
MNEHIPSKGM KCTPLLPLPT EHADDEPIYV NAKQYHAIIR RRQRRKIVGS EDKVAAIRKR 60 ILFEARQKQA KLRRRGKGGR FISIEHPLEL SMDDQISKNG GSASPSSSTV SENSSNVNGF 120 TGDELCSRQL S |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 3e-14 | 25 | 83 | 2 | 60 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU847005 | 0.0 | EU847005.1 Oryza sativa Japonica Group clone KCS241E10 CCAAT-binding transcription factor mRNA, complete cds. | |||
| GenBank | HQ731478 | 0.0 | HQ731478.1 Oryza sativa Japonica Group NF-Y transcription factor 21 (NF-Y21) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015613426.1 | 4e-62 | nuclear transcription factor Y subunit A-3 | ||||
| TrEMBL | A0A0E0EXG0 | 4e-92 | A0A0E0EXG0_9ORYZ; Uncharacterized protein | ||||
| STRING | OMERI10G06020.1 | 2e-85 | (Oryza meridionalis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP17468 | 10 | 10 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G72830.1 | 7e-17 | nuclear factor Y, subunit A3 | ||||




