![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | ONIVA05G12010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 127aa MW: 14393.8 Da PI: 9.5345 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 54.3 | 2.3e-17 | 3 | 52 | 8 | 57 |
-HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
Homeobox 8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
t++qle+L++ + ++ yp+++ r+eL+ klgLt++q ++WF+ rR k++k
ONIVA05G12010.1 3 TPYQLEVLKRTYTEDLYPNETIRAELSVKLGLTDKQLQMWFCHRRLKDRK 52
89**********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 14.382 | 1 | 53 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 4.1E-8 | 1 | 57 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 2.74E-14 | 2 | 52 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 1.35E-12 | 2 | 53 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.2E-15 | 3 | 52 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 4.4E-15 | 3 | 52 | IPR001356 | Homeobox domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
MKTPYQLEVL KRTYTEDLYP NETIRAELSV KLGLTDKQLQ MWFCHRRLKD RKPPPKRQQL 60 EEDVHVPVMA PPPVLPPPLP HSKLTMAPGG MYGEQLLPSS SRRGTGRPSA ILDMSDLQCL 120 PLLTSHG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CP012613 | 0.0 | CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015639400.1 | 3e-47 | homeobox-DDT domain protein RLT2 isoform X1 | ||||
| Refseq | XP_015639401.1 | 3e-47 | homeobox-DDT domain protein RLT2 isoform X2 | ||||
| Swissprot | Q9FFH1 | 1e-20 | RLT2_ARATH; Homeobox-DDT domain protein RLT2 | ||||
| TrEMBL | A0A0E0HCK4 | 7e-87 | A0A0E0HCK4_ORYNI; Uncharacterized protein | ||||
| STRING | ONIVA05G12010.1 | 1e-87 | (Oryza nivara) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP23525 | 4 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G28420.1 | 2e-17 | homeobox-1 | ||||




