![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | OPUNC03G01630.6 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 194aa MW: 21859.8 Da PI: 8.809 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 95.3 | 2.7e-30 | 2 | 52 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
OPUNC03G01630.6 2 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 52
79***********************************************86 PP
| |||||||
| 2 | K-box | 50.1 | 1.2e-17 | 71 | 135 | 6 | 70 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70
g+++ +++ e+ + +++ L k++e L+ +R+llGe+Le++s++eL++Le +Le+sl +iR +K
OPUNC03G01630.6 71 GNKTVQQDIEQIKADAEGLAKKLEALEAYKRKLLGEKLEECSIEELHSLEVKLERSLISIRGRKC 135
45577888999****************************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 4.0E-32 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.931 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 9.77E-40 | 1 | 67 | No hit | No description |
| SuperFamily | SSF55455 | 8.37E-31 | 1 | 77 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.7E-27 | 3 | 50 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.9E-19 | 16 | 31 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.9E-19 | 31 | 52 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 5.9E-17 | 76 | 135 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 8.487 | 79 | 171 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 194 aa Download sequence Send to blast |
MKRIENPTSR QVTFSKRRNG LLKKAFELSV LCDAEVALIV FSPRGKLYEF ASASTQKTIE 60 RYRTYTKENI GNKTVQQDIE QIKADAEGLA KKLEALEAYK RKLLGEKLEE CSIEELHSLE 120 VKLERSLISI RGRKCKNQPA MSAPSSVRAE DENPDRNINT TNDEMDVETE LFIGLPGRSR 180 SSGAAEDSRA KPHS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3kov_A | 1e-17 | 1 | 65 | 7 | 71 | Myocyte-specific enhancer factor 2A |
| 3kov_B | 1e-17 | 1 | 65 | 7 | 71 | Myocyte-specific enhancer factor 2A |
| 3kov_I | 1e-17 | 1 | 65 | 7 | 71 | Myocyte-specific enhancer factor 2A |
| 3kov_J | 1e-17 | 1 | 65 | 7 | 71 | Myocyte-specific enhancer factor 2A |
| 3mu6_A | 7e-18 | 3 | 65 | 9 | 71 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 7e-18 | 3 | 65 | 9 | 71 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 7e-18 | 3 | 65 | 9 | 71 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 7e-18 | 3 | 65 | 9 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_A | 1e-17 | 1 | 65 | 7 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_B | 1e-17 | 1 | 65 | 7 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_C | 1e-17 | 1 | 65 | 7 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_D | 1e-17 | 1 | 65 | 7 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_I | 1e-17 | 1 | 65 | 7 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_J | 1e-17 | 1 | 65 | 7 | 71 | Myocyte-specific enhancer factor 2A |
| 5f28_A | 1e-17 | 3 | 65 | 10 | 72 | MEF2C |
| 5f28_B | 1e-17 | 3 | 65 | 10 | 72 | MEF2C |
| 5f28_C | 1e-17 | 3 | 65 | 10 | 72 | MEF2C |
| 5f28_D | 1e-17 | 3 | 65 | 10 | 72 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB003328 | 0.0 | AB003328.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:S11905. | |||
| GenBank | AK067641 | 0.0 | AK067641.1 Oryza sativa Japonica Group cDNA clone:J013108C22, full insert sequence. | |||
| GenBank | AK104921 | 0.0 | AK104921.1 Oryza sativa Japonica Group cDNA clone:001-047-H02, full insert sequence. | |||
| GenBank | AY332476 | 0.0 | AY332476.1 Oryza sativa (japonica cultivar-group) MADS box protein (AGL20) mRNA, complete cds. | |||
| GenBank | CT830037 | 0.0 | CT830037.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA030D10, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015630979.1 | 1e-126 | MADS-box transcription factor 50 | ||||
| Refseq | XP_025880188.1 | 1e-126 | MADS-box transcription factor 50 | ||||
| Swissprot | Q9XJ60 | 1e-127 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
| TrEMBL | A0A0E0K838 | 1e-139 | A0A0E0K838_ORYPU; Uncharacterized protein | ||||
| STRING | OMERI03G01700.1 | 1e-124 | (Oryza meridionalis) | ||||
| STRING | OS03T0122600-01 | 1e-125 | (Oryza sativa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.4 | 2e-58 | AGAMOUS-like 42 | ||||




