PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OPUNC12G02170.3

Organism

Oryza punctata

Taxonomic ID

4537

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

bZIP

Protein Properties

Length: 246aa MW: 27119.7 Da PI: 7.0136

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OPUNC12G02170.3	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	32.5	1.9e-10	78	122	6	50
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 ++ + NReA r++Rq+Kka +++Lee+vk L a N++L k+l+ OPUNC12G02170.3 78 KAHKPLGNREAVRKYRQKKKAHTAHLEEEVKRLRAINQQLLKRLQ 122 6667778**********************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	6.5E-8	71	140	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	7.2E-13	73	141	No hit	No description
CDD	cd14686	6.56E-12	78	131	No hit	No description
SuperFamily	SSF57959	3.25E-7	79	123	No hit	No description
Pfam	PF07716	3.7E-11	82	130	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005829	Cellular Component	cytosol
GO:0000166	Molecular Function	nucleotide binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 246 aa Download sequence Send to blast
MDDGEIELSS QMMFPNAETP TSLDDFLPSI RTTCTHTHTC NPPGPSATAH THTCYHTHTQ 60 VFSTDDDSCG GDKPKRNKAH KPLGNREAVR KYRQKKKAHT AHLEEEVKRL RAINQQLLKR 120 LQGQAALEAE VVRLRLLLVD VRSRINGALG CDGMAQCFAE KPELGVRRSC APSIVNCHIS 180 QDSGQNIVVP HTLSPSDAIG SFMVSSTSKD ELILTQICNG QLEMPDEQHK PLMPDAISHS 240 HVDTLS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269\|PubMed:20479230, ECO:0000269\|PubMed:26306426}.
UniProt	Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269\|PubMed:20479230, ECO:0000269\|PubMed:26306426}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by zinc deficiency. {ECO:0000269\|PubMed:20479230}.
UniProt	INDUCTION: Induced by zinc deficiency. {ECO:0000269\|PubMed:20479230}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC123527	1e-175	AC123527.3 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0068G15, complete sequence.
GenBank	AK103113	1e-175	AK103113.1 Oryza sativa Japonica Group cDNA clone:J033119E15, full insert sequence.
GenBank	AK120730	1e-175	AK120730.1 Oryza sativa Japonica Group cDNA clone:J023003B09, full insert sequence.
GenBank	AP014967	1e-175	AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBank	FQ378034	1e-175	FQ378034.1 Oryza glaberrima chromosome 11.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015619735.1	1e-116	basic leucine zipper 23-like
Swissprot	Q8GTS2	4e-50	BZP23_ARATH; Basic leucine zipper 23
Swissprot	Q8VY76	5e-50	BZP19_ARATH; Basic leucine zipper 19
TrEMBL	A0A0E0MJE8	0.0	A0A0E0MJE8_ORYPU; Uncharacterized protein
STRING	OMERI12G01040.2	1e-103	(Oryza meridionalis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G16770.1	2e-25	bZIP family protein

Publications ? help Back to Top
Azevedo H, et al. Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply. Genom Data, 2016. 7: p. 256-8 [PMID:26981422] Castro PH, et al. Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants. Sci Rep, 2017. 7(1): p. 3806 [PMID:28630437] Henriques AR,Farias DDR,Costa de Oliveira A Identification and characterization of the bZIP transcription factor involved in zinc homeostasis in cereals. Genet. Mol. Res., 2017. [PMID:28671251] Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE F-group bZIPs in barley-a role in Zn deficiency. Plant Cell Environ., 2017. 40(11): p. 2754-2770 [PMID:28763829] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]