PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

ORGLA10G0167300.1

Organism

Oryza glaberrima

Taxonomic ID

4538

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

CAMTA

Protein Properties

Length: 137aa MW: 16269.7 Da PI: 9.7389

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
ORGLA10G0167300.1	genome	AGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	186.6	2.5e-58	21	137	2	118
CG-1 2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenpt 93 l+ ++rwl+++ei++iL n++k++++ e+++rp sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+hekLKvg+v+vl+cyYah+een++ ORGLA10G0167300.1 21 LEAQNRWLRPTEICHILSNYKKFSIAPEPPNRPASGSLFLFDRKILRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENEN 112 5669************************************************************************************** PP CG-1 94 fqrrcywlLeeelekivlvhylevk 118 fqrr+ywlLee + +ivlvhylevk ORGLA10G0167300.1 113 FQRRTYWLLEEGFMNIVLVHYLEVK 137 ********************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	79.933	16	137	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	2.5E-76	19	137	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	4.7E-52	22	136	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
MAEVRKYGLP NQPPDISQIL LEAQNRWLRP TEICHILSNY KKFSIAPEPP NRPASGSLFL 60 FDRKILRYFR KDGHNWRKKK DGKTVKEAHE KLKVGSVDVL HCYYAHGEEN ENFQRRTYWL 120 LEEGFMNIVL VHYLEVK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	ORGLA10G0167300.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP004341	2e-60	AP004341.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0524E08.
GenBank	AP014963	2e-60	AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBank	CP012615	2e-60	CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015647012.1	8e-93	calmodulin-binding transcription activator 1 isoform X1
Swissprot	Q6NPP4	5e-68	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	A0A0D3GTQ7	2e-92	A0A0D3GTQ7_9ORYZ; Uncharacterized protein
TrEMBL	I1QWU0	2e-98	I1QWU0_ORYGL; Uncharacterized protein
STRING	ORGLA10G0167300.1	3e-99	(Oryza glaberrima)
STRING	OBART07G22710.1	4e-93	(Oryza barthii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP608	38	140

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64220.2	2e-70	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]