PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

ORGLA11G0120100.1

Organism

Oryza glaberrima

Taxonomic ID

4538

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MYB_related

Protein Properties

Length: 71aa MW: 7848.87 Da PI: 4.1776

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
ORGLA11G0120100.1	genome	AGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	31.4	4.4e-10	33	71	3	43
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 +WT +E +ll++a + l + W Ia+++ ++t qc ++ ORGLA11G0120100.1 33 SWTDQETLLLLEALEILQAK-WGDIAEHVA-TKTKAQCMLH 71 7*****************.*****.*****998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51293	16.141	29	71	IPR017884	SANT domain
SuperFamily	SSF46689	1.72E-9	29	71	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.2E-7	32	71	IPR009057	Homeodomain-like
Pfam	PF00249	4.5E-9	33	71	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 71 aa Download sequence Send to blast
LHDYDKGNLD AGMSQTDFII MESAEIPGFG GTSWTDQETL LLLEALEILQ AKWGDIAEHV 60 ATKTKAQCML H

Functional Description ? help Back to Top
Source	Description
UniProt	Component of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	ORGLA11G0120100.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AL442118	1e-108	AL442118.2 Oryza sativa genomic DNA, chromosome 4, BAC clone: H0201G08, complete sequence.
GenBank	CP012612	1e-108	CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015633469.1	6e-32	SWI/SNF complex subunit SWI3D isoform X1
Refseq	XP_015633471.1	5e-32	SWI/SNF complex subunit SWI3D isoform X2
Swissprot	Q8VY05	2e-13	SWI3D_ARATH; SWI/SNF complex subunit SWI3D
TrEMBL	I1R0A9	9e-45	I1R0A9_ORYGL; Uncharacterized protein
STRING	ORGLA11G0120100.1	1e-45	(Oryza glaberrima)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP21939	4	4

Publications ? help Back to Top
Sarnowski TJ,Swiezewski S,Pawlikowska K,Kaczanowski S,Jerzmanowski A AtSWI3B, an Arabidopsis homolog of SWI3, a core subunit of yeast Swi/Snf chromatin remodeling complex, interacts with FCA, a regulator of flowering time. Nucleic Acids Res., 2002. 30(15): p. 3412-21 [PMID:12140326] Zhou C,Miki B,Wu K CHB2, a member of the SWI3 gene family, is a global regulator in Arabidopsis. Plant Mol. Biol., 2003. 52(6): p. 1125-34 [PMID:14682613] Sarnowski TJ, et al. SWI3 subunits of putative SWI/SNF chromatin-remodeling complexes play distinct roles during Arabidopsis development. Plant Cell, 2005. 17(9): p. 2454-72 [PMID:16055636] Liu ZW, et al. The SET domain proteins SUVH2 and SUVH9 are required for Pol V occupancy at RNA-directed DNA methylation loci. PLoS Genet., 2014. 10(1): p. e1003948 [PMID:24465213] Liu ZW, et al. Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis. PLoS Genet., 2016. 12(5): p. e1006026 [PMID:27171427]