![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | ORUFI01G39650.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 158aa MW: 17010.2 Da PI: 7.5036 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 176.6 | 2.4e-55 | 18 | 111 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrkting+dll+a++tlGfe+yv+plk+yl+kyre +
ORUFI01G39650.1 18 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGEDLLFAMGTLGFEEYVDPLKIYLHKYREGD 111
69*****************************************************************************************965 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 9.3E-53 | 16 | 120 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.64E-39 | 21 | 116 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.8E-28 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.0E-22 | 52 | 70 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.0E-22 | 71 | 89 | No hit | No description |
| PRINTS | PR00615 | 2.0E-22 | 90 | 108 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 158 aa Download sequence Send to blast |
MADAGHDESG SPPRSGGVRE QDRFLPIANI SRIMKKAVPA NGKIAKDAKE TLQECVSEFI 60 SFVTSEASDK CQKEKRKTIN GEDLLFAMGT LGFEEYVDPL KIYLHKYREG DSKLSSKAGD 120 GSVKKDTIGP HSGASSSSAQ GMVGAYTQGM GYMQPQVT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 4e-49 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 4e-49 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB095438 | 0.0 | AB095438.1 Oryza sativa Japonica Group OsHAP3A mRNA for HAP3, complete cds. | |||
| GenBank | AY332466 | 0.0 | AY332466.1 Oryza sativa (japonica cultivar-group) CCAAT-binding protein (CCB1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015611523.1 | 1e-103 | nuclear transcription factor Y subunit B-2 isoform X2 | ||||
| Swissprot | Q5QMG3 | 1e-103 | NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2 | ||||
| TrEMBL | A0A0D9YGX6 | 1e-113 | A0A0D9YGX6_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A0A0D9YGX7 | 1e-113 | A0A0D9YGX7_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A0A0E0FVE2 | 1e-113 | A0A0E0FVE2_ORYNI; Uncharacterized protein | ||||
| TrEMBL | A0A0E0FVE3 | 1e-113 | A0A0E0FVE3_ORYNI; Uncharacterized protein | ||||
| TrEMBL | A0A0E0N4L4 | 1e-113 | A0A0E0N4L4_ORYRU; Uncharacterized protein | ||||
| TrEMBL | A0A0E0N4L5 | 1e-113 | A0A0E0N4L5_ORYRU; Uncharacterized protein | ||||
| STRING | OGLUM01G40190.1 | 1e-113 | (Oryza glumipatula) | ||||
| STRING | ORUFI01G39650.2 | 1e-113 | (Oryza rufipogon) | ||||
| STRING | ONIVA01G41260.2 | 1e-113 | (Oryza nivara) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 7e-66 | nuclear factor Y, subunit B10 | ||||




