![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | ORUFI01G46540.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 178aa MW: 18643.4 Da PI: 6.7794 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 135 | 2.3e-42 | 35 | 126 | 3 | 94 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
qd++lPianv+rimk lP +akisk aket+qec++efisfvt+eas++c+re+r t +gdd+++a+ +lG+++y+++++ yl++yre e
ORUFI01G46540.1 35 GQDNLLPIANVGRIMKDGLPPQAKISKRAKETIQECATEFISFVTGEASERCRRERRETGDGDDVCHAMRSLGLDHYADAMHRYLQRYREGE 126
69***************************************************************************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 3.4E-38 | 32 | 131 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.1E-29 | 36 | 137 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.5E-20 | 40 | 103 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 6.7E-11 | 67 | 85 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 70 | 86 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 6.7E-11 | 86 | 104 | No hit | No description |
| PRINTS | PR00615 | 6.7E-11 | 105 | 123 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 178 aa Download sequence Send to blast |
MQGLPRASSS STSASRDRDG GDGDGGGGGV TMTNGQDNLL PIANVGRIMK DGLPPQAKIS 60 KRAKETIQEC ATEFISFVTG EASERCRRER RETGDGDDVC HAMRSLGLDH YADAMHRYLQ 120 RYREGEELAA SLNSSSSAAA AAAAAAAAGS RGGGAIQIDV RAELSIFRSG NNQGRPNN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-36 | 36 | 124 | 4 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-36 | 36 | 124 | 4 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CP012609 | 0.0 | CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025878241.1 | 2e-83 | nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O04027 | 2e-40 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O82248 | 5e-40 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | Q75IZ7 | 2e-39 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A0E0N7B4 | 1e-125 | A0A0E0N7B4_ORYRU; Uncharacterized protein | ||||
| STRING | ORUFI01G46540.1 | 1e-126 | (Oryza rufipogon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 1e-35 | nuclear factor Y, subunit B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




