![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | ORUFI03G01510.5 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 99aa MW: 11418.4 Da PI: 10.841 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 97.3 | 6.3e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
ORUFI03G01510.5 9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 59
79***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 9.8E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.595 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 7.46E-30 | 3 | 67 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.7E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.02E-37 | 3 | 59 | No hit | No description |
| Pfam | PF00319 | 4.1E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.7E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.7E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000060 | Biological Process | protein import into nucleus, translocation | ||||
| GO:0009409 | Biological Process | response to cold | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0009911 | Biological Process | positive regulation of flower development | ||||
| GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008134 | Molecular Function | transcription factor binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGKLYEFASA 60 RKIRPEKTAK TIFPRVAIEL PSKQSHYFHK EISCETGKY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3mu6_A | 2e-18 | 3 | 59 | 2 | 58 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 2e-18 | 3 | 59 | 2 | 58 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 2e-18 | 3 | 59 | 2 | 58 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 2e-18 | 3 | 59 | 2 | 58 | Myocyte-specific enhancer factor 2A |
| 5f28_A | 2e-18 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_B | 2e-18 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_C | 2e-18 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_D | 2e-18 | 1 | 60 | 1 | 60 | MEF2C |
| 6byy_A | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_B | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_C | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_D | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_A | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_B | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_C | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_D | 2e-18 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00076 | ChIP-chip | Transfer from AT2G45660 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY551915 | 1e-161 | AY551915.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS210 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006649298.1 | 2e-35 | PREDICTED: MADS-box transcription factor 50-like | ||||
| Refseq | XP_007134936.1 | 1e-35 | hypothetical protein PHAVU_010G088100g | ||||
| Refseq | XP_007134937.1 | 1e-35 | hypothetical protein PHAVU_010G088100g | ||||
| Refseq | XP_015630979.1 | 2e-35 | MADS-box transcription factor 50 | ||||
| Refseq | XP_015691000.1 | 2e-35 | PREDICTED: MADS-box transcription factor 50-like | ||||
| Refseq | XP_015691001.1 | 2e-35 | PREDICTED: MADS-box transcription factor 50-like | ||||
| Refseq | XP_025880188.1 | 2e-35 | MADS-box transcription factor 50 | ||||
| Swissprot | Q9XJ60 | 1e-36 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
| TrEMBL | A0A0E0NNZ7 | 1e-66 | A0A0E0NNZ7_ORYRU; Uncharacterized protein | ||||
| STRING | OBART03G01800.1 | 2e-66 | (Oryza barthii) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45660.1 | 1e-36 | AGAMOUS-like 20 | ||||




