![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | ORUFI03G21780.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 101aa MW: 11186 Da PI: 10.2728 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 56.2 | 8.1e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+WT+ Ed++lv +++++G g W + +++ g++R++k+c++rw++yl
ORUFI03G21780.1 14 RGAWTAMEDDILVSYIAKHGEGKWGALPKRAGLKRCGKSCRLRWLNYL 61
89*********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.3E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 21.922 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.5E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 3.9E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 8.53E-21 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.47E-11 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.8E-6 | 65 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MGRKPCCSKE GLNRGAWTAM EDDILVSYIA KHGEGKWGAL PKRAGLKRCG KSCRLRWLNY 60 LRPGIKRGNI SGDEEELILR LHTLLGNRPV SDPLLSSSPA N |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 1e-13 | 12 | 88 | 25 | 100 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | D88619 | 1e-145 | D88619.1 Oryza sativa mRNA for OSMYB3, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015629423.1 | 2e-57 | anthocyanin regulatory C1 protein | ||||
| Swissprot | P10290 | 1e-42 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
| TrEMBL | A0A0E0NWF0 | 1e-66 | A0A0E0NWF0_ORYRU; Uncharacterized protein | ||||
| STRING | ORUFI03G21780.1 | 2e-67 | (Oryza rufipogon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP116 | 37 | 448 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G16720.1 | 3e-42 | myb domain protein 7 | ||||




