![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | ORUFI05G20720.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 84aa MW: 8158.02 Da PI: 7.3637 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 87.5 | 1.5e-27 | 36 | 84 | 1 | 49 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49
vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tse
ORUFI05G20720.1 36 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSE 84
69*********************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 1.08E-17 | 19 | 84 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 2.9E-25 | 34 | 84 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.4E-17 | 42 | 84 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MADGPGSPGG GGGSHESGSP RGGGGGGGGG GGGGGVREQD RFLPIANISR IMKKAIPANG 60 KIAKDAKETV QECVSEFISF ITSE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-23 | 35 | 84 | 1 | 50 | NF-YB |
| 4awl_B | 2e-23 | 35 | 84 | 2 | 51 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-23 | 35 | 84 | 2 | 51 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC108500 | 1e-140 | AC108500.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1280_A04, complete sequence. | |||
| GenBank | AP014961 | 1e-140 | AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015639303.1 | 2e-51 | nuclear transcription factor Y subunit B-3 | ||||
| Refseq | XP_015639304.1 | 2e-51 | nuclear transcription factor Y subunit B-3 | ||||
| Refseq | XP_015639305.1 | 2e-51 | nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | Q60EQ4 | 1e-52 | NFYB3_ORYSJ; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | B7EQX8 | 3e-50 | B7EQX8_ORYSJ; cDNA clone:J023121O11, full insert sequence | ||||
| TrEMBL | I1PWE8 | 3e-50 | I1PWE8_ORYGL; Uncharacterized protein | ||||
| STRING | ORGLA05G0169600.1 | 6e-51 | (Oryza glaberrima) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP18750 | 5 | 9 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.7 | 1e-28 | nuclear factor Y, subunit B1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




