PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

ORUFI07G07450.1

Organism

Oryza rufipogon

Taxonomic ID

4529

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MYB

Protein Properties

Length: 178aa MW: 20338.2 Da PI: 9.3223

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
ORUFI07G07450.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.5	1e-15	14	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEde l + v+ +G W+ Ia+ ++ t+kqc++rw ++l ORUFI07G07450.1 14 KGGWTREEDEVLRQMVRHHGDCKWTEIAKSLP-SQTGKQCRERWTNHL 60 688***************************.**********996 PP
2	Myb_DNA-binding	25.8	2.5e-08	67	104	6	45
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +eE+ +l+++++ +G++ W++I r + g +++ +k++w+ ORUFI07G07450.1 67 EEEHMKLIEVHRTYGNR-WSAIVRWLL-GWSENTVKNHWN 104 7**************.****9.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	21.803	9	64	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.2E-19	13	60	IPR009057	Homeodomain-like
SMART	SM00717	1.1E-13	13	62	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.96E-24	14	107	IPR009057	Homeodomain-like
Pfam	PF00249	9.4E-15	14	60	IPR001005	SANT/Myb domain
CDD	cd00167	1.37E-13	17	60	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.0E-8	67	106	IPR009057	Homeodomain-like
CDD	cd00167	2.08E-5	67	104	No hit	No description
SMART	SM00717	0.15	67	109	IPR001005	SANT/Myb domain
PROSITE profile	PS50090	6.028	67	104	IPR017877	Myb-like domain
Pfam	PF00249	1.5E-6	67	104	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
MQAAGSNGNL GLIKGGWTRE EDEVLRQMVR HHGDCKWTEI AKSLPSQTGK QCRERWTNHL 60 YSEIKIEEEH MKLIEVHRTY GNRWSAIVRW LLGWSENTVK NHWNPTKRSL NSKQRLRKKN 120 SEKAAPGQPS HLEECICSFQ NPLLDETAPP PLAPPAPFDI VRYGTCRLIG VIPTPPAI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-26	12	112	5	110	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269\|PubMed:16214903, ECO:0000269\|PubMed:17693534, ECO:0000269\|PubMed:17937500, ECO:0000269\|PubMed:18410484, ECO:0000269\|PubMed:23093426}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP012615	0.0	CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBank	DQ989628	0.0	DQ989628.1 Oryza sativa (indica cultivar-group) clone BAC 21O9, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015645903.1	7e-78	transcription factor MYB119
Swissprot	Q9S7L2	2e-29	MYB98_ARATH; Transcription factor MYB98
TrEMBL	A0A0E0Q5P0	1e-129	A0A0E0Q5P0_ORYRU; Uncharacterized protein
STRING	ORUFI07G07450.1	1e-130	(Oryza rufipogon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1882	33	101

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18770.1	9e-32	myb domain protein 98

Publications ? help Back to Top
Mendes MA, et al. Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis. Development, 2016. 143(15): p. 2780-90 [PMID:27338615]