![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_04043A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 133aa MW: 14626.5 Da PI: 10.2599 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 42 | 2.1e-13 | 62 | 106 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+W++eE+ l++ + ++lG g+W+ I+r + ++Rt+ q+ s+ qk+
Oropetium_20150105_04043A 62 PWSEEEHRLFLVGLEKLGRGDWRGISRGFVTTRTPTQVASHAQKF 106
8******************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 16.383 | 55 | 111 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.32E-17 | 57 | 112 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 2.9E-17 | 58 | 110 | IPR006447 | Myb domain, plants |
| SMART | SM00717 | 9.0E-10 | 59 | 109 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-10 | 59 | 102 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.2E-10 | 62 | 105 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 4.89E-10 | 62 | 107 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 133 aa Download sequence Send to blast |
MEDCLTLQGS ASPPIYYALG APLFLSSMDK GGEMRANTEG GLSDDGGPGG PAAFRERKKG 60 VPWSEEEHRL FLVGLEKLGR GDWRGISRGF VTTRTPTQVA SHAQKFFLRQ NSAGKKNGKR 120 RERKNYSYYQ LV* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_04043A |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF184673 | 4e-68 | KF184673.1 Saccharum hybrid cultivar R570 clone BAC 008G08 complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004961036.3 | 1e-48 | transcription factor SRM1 | ||||
| Swissprot | Q7XC57 | 4e-31 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
| TrEMBL | A0A368QE50 | 3e-47 | A0A368QE50_SETIT; Uncharacterized protein | ||||
| TrEMBL | K3Z7V4 | 3e-47 | K3Z7V4_SETIT; Uncharacterized protein | ||||
| STRING | Pavir.J35324.1.p | 3e-48 | (Panicum virgatum) | ||||
| STRING | Si022624m | 4e-48 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4932 | 30 | 66 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47390.1 | 3e-31 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_04043A |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




