![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_06520A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 67aa MW: 7795.99 Da PI: 10.7693 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 50.5 | 4.4e-16 | 1 | 44 | 10 | 53 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53
++kNRe+A rsR+RK+a+i eLe +vk L++eN++L+ + ++l+
Oropetium_20150105_06520A 1 MIKNRESAARSRARKQAYIRELEMEVKRLQQENESLRVKYDQLR 44
68***********************************9999986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 7.1E-15 | 1 | 44 | No hit | No description |
| Pfam | PF00170 | 6.8E-14 | 1 | 44 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 2.06E-12 | 1 | 44 | No hit | No description |
| SMART | SM00338 | 0.0018 | 1 | 49 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.45 | 1 | 44 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 67 aa Download sequence Send to blast |
MIKNRESAAR SRARKQAYIR ELEMEVKRLQ QENESLRVKY DQLRVYTEVP APSKTKKLQR 60 TPSASC* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_06520A |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF093789 | 1e-41 | EF093789.1 Zea mays delayed flowering1 (DLF1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004957504.1 | 1e-25 | ABSCISIC ACID-INSENSITIVE 5-like protein 5 | ||||
| Swissprot | Q9LES3 | 2e-15 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
| TrEMBL | A0A0A9GMW6 | 8e-26 | A0A0A9GMW6_ARUDO; DLF1 | ||||
| STRING | Si031077m | 6e-25 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP9764 | 30 | 44 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G56850.1 | 9e-18 | ABA-responsive element binding protein 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_06520A |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




