![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_09502A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 86aa MW: 9648.15 Da PI: 12.3647 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 63.2 | 6.6e-20 | 5 | 68 | 7 | 70 |
DUF260 7 vlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearar 70
lrr+C+++Cvlapyfpa+q ++f++vh++FGasnv k+l++l+ e+r +a + l ar r
Oropetium_20150105_09502A 5 RLRRRCVPSCVLAPYFPAHQGARFRAVHRVFGASNVAKMLADLRLEDRAEASERLRERTMARSR 68
689**********************************************999888766666665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 14.783 | 1 | 85 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 4.8E-20 | 4 | 76 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MTRRRLRRRC VPSCVLAPYF PAHQGARFRA VHRVFGASNV AKMLADLRLE DRAEASERLR 60 ERTMARSRAR FAGTCGSRPS ASSRT* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-15 | 4 | 77 | 16 | 89 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-15 | 4 | 77 | 16 | 89 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_09502A |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009421201.1 | 5e-17 | PREDICTED: LOB domain-containing protein 12-like | ||||
| Swissprot | O22132 | 4e-16 | LBD19_ARATH; LOB domain-containing protein 19 | ||||
| STRING | Lus10007525 | 1e-16 | (Linum usitatissimum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP882 | 38 | 150 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G06280.1 | 5e-16 | LOB domain-containing protein 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_09502A |




