PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Oropetium_20150105_10729A

Organism

Oropetium thomaeum

Taxonomic ID

1148796

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium

Family

M-type_MADS

Protein Properties

Length: 68aa MW: 7866.21 Da PI: 10.8861

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Oropetium_20150105_10729A	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.7	1.1e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtf+kRrng+lKKA+ELS+LCdaeva+i+fss+g+lyeys+ Oropetium_20150105_10729A 9 KRIENNTSRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSSRGRLYEYSN 59 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.053	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	5.1E-40	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.01E-36	2	62	No hit	No description
SuperFamily	SSF55455	6.93E-30	2	63	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.1E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.2E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.1E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.1E-33	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 68 aa Download sequence Send to blast
MGRGRVEIKR IENNTSRQVT FCKRRNGLLK KAYELSILCD AEVALIVFSS RGRLYEYSNN 60 RFVLRIL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	6e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_Q	6e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_R	6e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_S	6e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_A	6e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_B	6e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_C	6e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_D	6e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_E	6e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_F	6e-20	1	60	1	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Oropetium_20150105_10729A

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF761668	5e-72	KF761668.1 Triticum aestivum cultivar Triple Dirk F-Japan line MADS-box transcription factor AGL31 (AGL31) gene, exons 1, 2, and 5 through 7, promoter region and partial cds.
GenBank	KF761669	5e-72	KF761669.1 Triticum aestivum cultivar Hayakomugi MADS-box transcription factor AGL31 (AGL31) gene, exons 1, 2, and 5 through 7, promoter region and partial cds.
GenBank	KF761670	5e-72	KF761670.1 Triticum aestivum cultivar Triple Dirk C line MADS-box transcription factor AGL31 (AGL31) gene, exons 1, 2, and 5 through 7, promoter region and partial cds.
GenBank	KF761671	5e-72	KF761671.1 Triticum aestivum cultivar Chinese Spring Synthetic 5402 line MADS-box transcription factor AGL31 (AGL31) gene, exons 1, 2, and 5 through 7, promoter region and partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004960786.1	4e-35	MADS-box transcription factor 13
Swissprot	Q2QW53	3e-35	MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBL	A0A287EXH2	1e-35	A0A287EXH2_HORVV; Uncharacterized protein
TrEMBL	A0A287EXI8	1e-35	A0A287EXI8_HORVV; Uncharacterized protein
STRING	Traes_3B_87AC5133F.2	2e-35	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.2	2e-36	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Oropetium_20150105_10729A

Publications ? help Back to Top
Gindullis F,Rose A,Patel S,Meier I Four signature motifs define the first class of structurally related large coiled-coil proteins in plants. BMC Genomics, 2002. 3: p. 9 [PMID:11972898] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yamaki S,Satoh H,Nagato Y Gypsy embryo specifies ovule curvature by regulating ovule/integument development in rice. Planta, 2005. 222(3): p. 408-17 [PMID:16001259] Dreni L, et al. The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice. Plant J., 2007. 52(4): p. 690-9 [PMID:17877710] Yamaki S,Nagato Y,Kurata N,Nonomura K Ovule is a lateral organ finally differentiated from the terminating floral meristem in rice. Dev. Biol., 2011. 351(1): p. 208-16 [PMID:21146515] Li H,Liang W,Yin C,Zhu L,Zhang D Genetic interaction of OsMADS3, DROOPING LEAF, and OsMADS13 in specifying rice floral organ identities and meristem determinacy. Plant Physiol., 2011. 156(1): p. 263-74 [PMID:21444646] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949]